PRGDB00062347 (E3 ligase)

From PRG Wiki
Jump to: navigation, search
E3 ligase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 324029072 (HQ123582)
Gene Class N
Domain Type NBS
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cultivar Taipei 309 E3 ligase (BBI1) gene, complete cds.

DNA Sequence

ATGGCCACCGTGGGGCAGCCTGATGCCATGAGAAGGATCACCGTTCACTACGTGAATCCGCCGCCGATCGCCGGCGCCGGAGAAGCACACGTCGATGGCCTCGACGACGAGGTTCTTGATTATGTGATTGGTGATGTTCTTCAGGATCAGGAGGGTCTGTATCAATCGATATTGTATGGCAAATACGGGGATGACATGAGAGGGGCAAGAAACACTGCTCTTGCCCAATCTGATGGTTTACATTACTACTATCACGGAGAGAACAGCAGTGGTGAAGCAACAACCTCGAGAAATTCAGAAATCGACCAACAGATTGAGTATGACTTGGTGTTCGCTAGGCAGCTGCAGGCAATGGATAATCTGACAATTGAGACACCTGCAGATGAAGATGATGATATAAGCTGCGTACCCTCTCCATCTGACTCTGAAACCGATGAACCGGCAGAAGGCAACAACGAAGAGGCTGCCACACAGGATGATAACGATGATCCAGACAACATGACATACGAGCAAAGGCAGGCACTTGTGGAATCTGTAGGAAATGAGAACAGAGGTTTATCTGATCTGCTTATCTCCTACTTGGAGACATGGAAGTACAAATCAGGCTTTTTCCCAAGGAAGGCAAACCATGATAACTGTCCTATATGTCTATCCGCTTTCAGACGCCGAGAAACACTCATTACATTGGCTTGCAAGCATAGTTACCATGAAGGTTGTATTGCTAGATGGCTCAAGATTGACAAGGCCTGCCCAGTTTGCAAATATGAAGTGTTTGGACCTTCCTAG


Protein sequences

Name Description Sequence
E3 ligase E3 ligase [Oryza sativa Japonica Group].

MATVGQPDAMRRITVHYVNPPPIAGAGEAHVDGLDDEVLDYVIGDVLQDQEGLYQSILYGKYGDDMRGARNTALAQSDGLHYYYHGENSSGEATTSRNSEIDQQIEYDLVFARQLQAMDNLTIETPADEDDDISCVPSPSDSETDEPAEGNNEEAATQDDNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGPS

E3 ligase E3 ligase [Oryza sativa Japonica Group].

MATVGQPDAMRRITVHYVNPPPIAGAGEAHVDGLDDEVLDYVIGDVLQDQEGLYQSILYGKYGDDMRGARNTALAQSDGLHYYYHGENSSGEATTSRNSEIDQQIEYDLVFARQLQAMDNLTIETPADEDDDISCVPSPSDSETDEPAEGNNEEAATQDDNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGPS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR14155:SF11
160-259 OS03G0173900 PROTEIN,OS03G0173900 PROTEIN

DNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFG

HMMPanther: PTHR14155
160-259 FAMILY NOT NAMED,RING FINGER PROTEIN 6/12/38

DNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFG

HMMPanther: PTHR14155:SF11
160-259 OS03G0173900 PROTEIN,OS03G0173900 PROTEIN

DNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFG

HMMPanther: PTHR14155
160-259 FAMILY NOT NAMED,RING FINGER PROTEIN 6/12/38

DNDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFG

superfamily: SSF57850
186-260 RING/U-box,NBS

LSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGP

superfamily: SSF57850
186-260 RING/U-box,NBS

LSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGP

Gene3D: G3DSA:3.30.40.10
IPR013083
209-257 no description
Zinc finger, RING/FYVE/PHD-type

NHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEV

Gene3D: G3DSA:3.30.40.10
IPR013083
209-257 no description
Zinc finger, RING/FYVE/PHD-type

NHDNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEV

HMMPfam: PF13639
211-254 zf-RING_2,Ring finger domain

DNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCK

HMMPfam: PF13639
211-254 zf-RING_2,Ring finger domain

DNCPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCK

ProfileScan: PS50089
IPR001841
213-254 ZF_RING_2
Zinc finger, RING-type

CPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCK

ProfileScan: PS50089
IPR001841
213-254 ZF_RING_2
Zinc finger, RING-type

CPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVCK

HMMSmart: SM00184
IPR001841
213-253 Ring finger
Zinc finger, RING-type

CPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVC

HMMSmart: SM00184
IPR001841
213-253 Ring finger
Zinc finger, RING-type

CPICLSAFRRRETLITLACKHSYHEGCIARWLKIDKACPVC


List of References

Wei Li, Sihui Zhong, Guojun Li, Qun Li, Bizeng Mao, Yiwen Deng, Huijuan Zhang, Longjun Zeng, Fengming Song, Zuhua He
Rice RING protein OsBBI1 with E3 ligase activity confers broad-spectrum resistance against Magnaporthe oryzae by modifying the cell wall defence.
Cell Res.: 2011, 21(5);835-48
PubMed:21221134 WorldCat.org DOI (I p)

Wei Li, Sihui Zhong, Guojun Li, Qun Li, Bizeng Mao, Yiwen Deng, Huijuan Zhang, Longjun Zeng, Fengming Song, Zuhua He
Rice RING protein OsBBI1 with E3 ligase activity confers broad-spectrum resistance against Magnaporthe oryzae by modifying the cell wall defence.
Cell Res.: 2011, 21(5);835-48
PubMed:21221134 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox