PRGDB00062349 (NBS-LRR-like protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 307829320 (HQ214676)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Pennisetum glaucum

Comment?

Pennisetum glaucum clone RGPM 213 NBS-LRR-like protein mRNA, complete cds.

DNA Sequence

ATGGCAACAATAATTGATTCTGTGGTTGGATCGCTTGCCAAAAAGTTGCAAGATATTATTTTTGAGGAAGCCATTTCAGTTCTGGGGGTAAAACGAGACCTCAAAGATCTAGAGAGAACAATGAACCATATACAATGCTTTCTGAAAGATGCAGAGCAAAGGAGGGCAGAAGAGTCAGCAGTTAACAATTGGCTTGGTGAGCTGGAAGATGCTATGTACGAAGCTGATGATATCATTGACTTGGCTACATTAGAAGGGCATAAGCTTCTAGCAGACCACGCATCACCATCAAGAAGGTCTGCTGAATGTTCAAGATTTCCACTTTTCACATGCCTTCCCACTATTCGAAGGCGTCACGAGATTGCCATTCGCATCAGGAAATTGAATACTGAATTAGAGAATGTTTTAAAACTAGGTGAAAGATTGTTAAAGCTTCAGAATGTGCAGCCTAAAGGTGAAGTTTCATTAGTGCATAGGATGAAAGCTTCTGACCTAGTGGAACCTAACCTTGTGGGAAAGGAAACCCATGTTGCTTGTAAAAGATTGGTTGGACTGATTCTTGCACACAGAGAAAAGAAGACATACAAGATTGGCATTGTTGGAACCGGAGGTGTTGGTAAAACGACTTTGGCCCAGAAAATATATAATAGCAACAAAATAAAAGGAACTTTTAGCAAACAAGCATGGATTTGTGTTTCCCAACAATACTCTGAAGACACTCTTTTGAAAGAGGTTCTACGAAACATTGGGGAAGATTATAGGCAAGATGAATCTGTTGGAGAACTCACCAAAAAGCTATCAATTGCTGTTGAAAATAAAACTTTATTTCTTGTGTTGGATGACATGTGGAAGCATGAGGCATGGACTAATCTACTAAGAACTCCACTAAACACTGCAACAACAACAATAATTCTTGTGACTACTCGTAACGATACAGTTGCACGAGCAATTGGTGTGGAAGATGTGCATCGAGTTGAATTGATGTCTGATGATGTAGGATGGGAGCTTCTTTGGAAGAGTATGAACATTAATGAAGAGGCTGAAGTACAAAACCTAAGGAGTATAGGGAAGGATATTGTCCGTATGTGTGGTGGCCTCCCCCTAGCCCTCAAGGTTACAGCTAGTGTTCTCGCATGCAAGGAGAAAACTGAGAATCAATGGCGGCAAATTCTAAAAAATAGTGCTTGGTCCATGAGCAAAGTTCCTATTGAGCTGAGAGGAGCACTATACTTGAGCTATGATGACCTACCATGGCACTTGAGACAATGTTTCCTCTTCTGCACCTTATATCCCGAAGATCATAGCATGTCTCAAAATGATCTTATAAGGTATTGGATTGCTGAAGGTTTTATACAAAAGCAAGAAGACCAACTTCTTGAGGATACAGCTAACGAATATTACAACGAATTGGTATATAGGAATCTCCTTCATCCAGACCCTGCTTATGCTGATTATTCTTGGTGTAAAATGCATGATCTTTTAAGAAGACTGGGTCAACATTTGTCCGAAGATGAATATTTTTGTGGAGATTTACATTCATTGGAAGCTAAGTCTTTATTAAAACTACGGCACATTTCAGTTTGTATAGATAAAGATTCCATAACTCTGCCCATTATGACCGGAGAGCATATCCGAGCACGAACATTACTCATCATCTGTACCAAGTCAGTAAGACTGGAAAATTCAATATTTACAAGGCTTTCGTGCGTAAGAGTTTTGGATTTGACTGATTCAATTATAGGAAAAGTTCCTGATTGCATTGGTACTTTAGTCCATCTAAGATTACTTGATCTTGATGGGACTGGCATATCCAATCTCCCTCAATCTATCGGTTCTCTCAAATACCTACAAATATTAAATTTGCAGTGGTGCCATTTTTTGCACAACCTTCCTTTGGCAATCACAAAATTGTGTAACTTGAGACGCTTGGGTCTTGATGGGACACCAATAAATCAAGTTCCAAAAGGGATAAGTGAGTTGAAGTATCTCAACGATTTACAAGGATTTCCAATTGGTGGTGGCAGTGATAATAGAGCTAGAATGCAAGATGGATGGAACCTAGACGAGCTATGTCATCTTTTGCAGTTGTGGAAGCTTGATATGATAAAGTTGGAAAGAGCATCTCCTTGTAGTATGGATTCATTGTTAGTAGACAAAAAGTTTCTCAAAAAAATAAATTTATTTTGTACTGTACGCATAGATGAGCCGTGTAGTGAAAAGGATGTAAACAATATTGAGAGGACTTTTGAGAAGCTAATCCCTCCACAGAGCATTGAAGATATAGGGTATTGGTTATTTCTTTGGTCGGAGGTTTCCCACCTGGCTTGGCACAACTAG


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Pennisetum glaucum].

MATIIDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDLQGFPIGGGSDNRARMQDGWNLDELCHLLQLWKLDMIKLERASPCSMDSLLVDKKFLKKINLFCTVRIDEPCSEKDVNNIERTFEKLIPPQSIEDIGYWLFLWSEVSHLAWHN

NBS-LRR-like protein NBS-LRR-like protein [Pennisetum glaucum].

MATIIDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDLQGFPIGGGSDNRARMQDGWNLDELCHLLQLWKLDMIKLERASPCSMDSLLVDKKFLKKINLFCTVRIDEPCSEKDVNNIERTFEKLIPPQSIEDIGYWLFLWSEVSHLAWHN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-666 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

HMMPanther: PTHR23155:SF230
5-666 PTHR23155:SF230,OS11G0674500 PROTEIN

IDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

HMMPanther: PTHR23155
5-666 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

HMMPanther: PTHR23155:SF230
5-666 PTHR23155:SF230,OS11G0674500 PROTEIN

IDSVVGSLAKKLQDIIFEEAISVLGVKRDLKDLERTMNHIQCFLKDAEQRRAEESAVNNWLGELEDAMYEADDIIDLATLEGHKLLADHASPSRRSAECSRFPLFTCLPTIRRRHEIAIRIRKLNTELENVLKLGERLLKLQNVQPKGEVSLVHRMKASDLVEPNLVGKETHVACKRLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQEDQLLEDTANEYYNELVYRNLLHPDPAYADYSWCKMHDLLRRLGQHLSEDEYFCGDLHSLEAKSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

Gene3D: G3DSA:3.40.50.300
181-314 G3DSA:3.40.50.300

RLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVA

Gene3D: G3DSA:3.40.50.300
181-314 G3DSA:3.40.50.300

RLVGLILAHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVA

HMMPfam: PF00931
IPR002182
188-454 NB-ARC,NBS
NB-ARC

AHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQ

HMMPfam: PF00931
IPR002182
188-454 NB-ARC,NBS
NB-ARC

AHREKKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSKVPIELRGALYLSYDDLPWHLRQCFLFCTLYPEDHSMSQNDLIRYWIAEGFIQKQ

superfamily: SSF52540
192-400 SSF52540

KKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSK

superfamily: SSF52540
192-400 SSF52540

KKTYKIGIVGTGGVGKTTLAQKIYNSNKIKGTFSKQAWICVSQQYSEDTLLKEVLRNIGEDYRQDESVGELTKKLSIAVENKTLFLVLDDMWKHEAWTNLLRTPLNTATTTIILVTTRNDTVARAIGVEDVHRVELMSDDVGWELLWKSMNINEEAEVQNLRSIGKDIVRMCGGLPLALKVTASVLACKEKTENQWRQILKNSAWSMSK

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KIGIVGTGGVGKTTLA

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

KIGIVGTGGVGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

AVENKTLFLVLDDMW

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

AVENKTLFLVLDDMW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CGGLPLALKVTASVL

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CGGLPLALKVTASVL

superfamily: SSF52058
517-666 SSF52058,LRR

KSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

superfamily: SSF52058
517-666 SSF52058,LRR

KSLLKLRHISVCIDKDSITLPIMTGEHIRARTLLIICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

Gene3D: G3DSA:3.80.10.10
551-666 G3DSA:3.80.10.10

IICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

Gene3D: G3DSA:3.80.10.10
551-666 G3DSA:3.80.10.10

IICTKSVRLENSIFTRLSCVRVLDLTDSIIGKVPDCIGTLVHLRLLDLDGTGISNLPQSIGSLKYLQILNLQWCHFLHNLPLAITKLCNLRRLGLDGTPINQVPKGISELKYLNDL

FPrintScan: PR00364
IPR000767
611-627 DISEASERSIST
Disease resistance protein

GSLKYLQILNLQWCHFL

FPrintScan: PR00364
IPR000767
611-627 DISEASERSIST
Disease resistance protein

GSLKYLQILNLQWCHFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox