PRGDB00062371 (tir-nbs-lrr resistance protein)

From PRG Wiki
Jump to: navigation, search
tir-nbs-lrr resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 116047827 (CM000351)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa linkage group XV, whole genome shotgun sequence.

DNA Sequence

CTTGCCACAGCTCTCTTCAATAAACTTGTGGGTCATTTTGAGAGTCGTAGTTTCATCTTGAACGTTAAAGATATTTCTAAAGAAGATGGTGGTCTAGTAAAACTGCAGAACAAACTTCTTCGTGATCTTTCCCCAAACTGGCCTCTTGTAAATAATATTGATAAAGGTGTTGCCGCAATCAAAATGTTGGTTCATGAGAAGCGGGTACTAATTGTCTTAGATGATGTGGATGATGTAAGCGAACTGAATGCACTAGCAGGGAATAGAAGCTGGTACGGTGAAGGAAGTCGAGTTATTGTTACAACAAGAAACAAAGCTGTTCTAGCTGAACACCTTGTCAATGAATTTTACGACGTTAGAGAGTTAGGTTACCCGGAAGCCTTACAACTTTTTAGTTATCATGCACTCAGAAAAGATAAACCCACAGAAGAATACATGAATATATCCAAGGAGATTGTGTCACTCACAGGAGGACTGCCTCTGGCTTTGGAAGTGTTTGGTTCTACTTTGTTTAATGAGAGAGGGTTAAATAGATGGGAAGATGCCCTGAAAAAACTGCAACGAATAAGGCCACATAATCTTCAGGATGTGTTACAAATAAGTTATGATGAGTTGGATGAAGATGAAAAG


Protein sequences

Name Description Sequence
tir-nbs-lrr resistance protein tir-nbs-lrr resistance protein [Populus trichocarpa].

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

tir-nbs-lrr resistance protein tir-nbs-lrr resistance protein [Populus trichocarpa].

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-210 PTHR11017:SF20,SUBFAMILY NOT NAMED

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

HMMPanther: PTHR11017
1-210 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

HMMPanther: PTHR11017:SF20
1-210 PTHR11017:SF20,SUBFAMILY NOT NAMED

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

HMMPanther: PTHR11017
1-210 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDEDEK

HMMPfam: PF00931
IPR002182
2-207 NB-ARC,NBS
NB-ARC

ATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDE

HMMPfam: PF00931
IPR002182
2-207 NB-ARC,NBS
NB-ARC

ATALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNLQDVLQISYDELDE

superfamily: SSF52540
3-194 SSF52540

TALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNL

superfamily: SSF52540
3-194 SSF52540

TALFNKLVGHFESRSFILNVKDISKEDGGLVKLQNKLLRDLSPNWPLVNNIDKGVAAIKMLVHEKRVLIVLDDVDDVSELNALAGNRSWYGEGSRVIVTTRNKAVLAEHLVNEFYDVRELGYPEALQLFSYHALRKDKPTEEYMNISKEIVSLTGGLPLALEVFGSTLFNERGLNRWEDALKKLQRIRPHNL

FPrintScan: PR00364
IPR000767
63-77 DISEASERSIST
Disease resistance protein

LVHEKRVLIVLDDVD

FPrintScan: PR00364
IPR000767
63-77 DISEASERSIST
Disease resistance protein

LVHEKRVLIVLDDVD

FPrintScan: PR00364
IPR000767
156-170 DISEASERSIST
Disease resistance protein

TGGLPLALEVFGSTL

FPrintScan: PR00364
IPR000767
156-170 DISEASERSIST
Disease resistance protein

TGGLPLALEVFGSTL


List of References

G A Tuskan, S Difazio, S Jansson, J Bohlmann, I Grigoriev, U Hellsten, N Putnam, S Ralph, S Rombauts, A Salamov, J Schein, L Sterck, A Aerts, R R Bhalerao, R P Bhalerao, D Blaudez, W Boerjan, A Brun, A Brunner, V Busov, M Campbell, J Carlson, M Chalot, J Chapman, G-L Chen, D Cooper, P M Coutinho, J Couturier, S Covert, Q Cronk, R Cunningham, J Davis, S Degroeve, A Déjardin, C Depamphilis, J Detter, B Dirks, I Dubchak, S Duplessis, J Ehlting, B Ellis, K Gendler, D Goodstein, M Gribskov, J Grimwood, A Groover, L Gunter, B Hamberger, B Heinze, Y Helariutta, B Henrissat, D Holligan, R Holt, W Huang, N Islam-Faridi, S Jones, M Jones-Rhoades, R Jorgensen, C Joshi, J Kangasjärvi, J Karlsson, C Kelleher, R Kirkpatrick, M Kirst, A Kohler, U Kalluri, F Larimer, J Leebens-Mack, J-C Leplé, P Locascio, Y Lou, S Lucas, F Martin, B Montanini, C Napoli, D R Nelson, C Nelson, K Nieminen, O Nilsson, V Pereda, G Peter, R Philippe, G Pilate, A Poliakov, J Razumovskaya, P Richardson, C Rinaldi, K Ritland, P Rouzé, D Ryaboy, J Schmutz, J Schrader, B Segerman, H Shin, A Siddiqui, F Sterky, A Terry, C-J Tsai, E Uberbacher, P Unneberg, J Vahala, K Wall, S Wessler, G Yang, T Yin, C Douglas, M Marra, G Sandberg, Y Van de Peer, D Rokhsar
The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
Science: 2006, 313(5793);1596-604
PubMed:16973872 WorldCat.org DOI (I p)

G A Tuskan, S Difazio, S Jansson, J Bohlmann, I Grigoriev, U Hellsten, N Putnam, S Ralph, S Rombauts, A Salamov, J Schein, L Sterck, A Aerts, R R Bhalerao, R P Bhalerao, D Blaudez, W Boerjan, A Brun, A Brunner, V Busov, M Campbell, J Carlson, M Chalot, J Chapman, G-L Chen, D Cooper, P M Coutinho, J Couturier, S Covert, Q Cronk, R Cunningham, J Davis, S Degroeve, A Déjardin, C Depamphilis, J Detter, B Dirks, I Dubchak, S Duplessis, J Ehlting, B Ellis, K Gendler, D Goodstein, M Gribskov, J Grimwood, A Groover, L Gunter, B Hamberger, B Heinze, Y Helariutta, B Henrissat, D Holligan, R Holt, W Huang, N Islam-Faridi, S Jones, M Jones-Rhoades, R Jorgensen, C Joshi, J Kangasjärvi, J Karlsson, C Kelleher, R Kirkpatrick, M Kirst, A Kohler, U Kalluri, F Larimer, J Leebens-Mack, J-C Leplé, P Locascio, Y Lou, S Lucas, F Martin, B Montanini, C Napoli, D R Nelson, C Nelson, K Nieminen, O Nilsson, V Pereda, G Peter, R Philippe, G Pilate, A Poliakov, J Razumovskaya, P Richardson, C Rinaldi, K Ritland, P Rouzé, D Ryaboy, J Schmutz, J Schrader, B Segerman, H Shin, A Siddiqui, F Sterky, A Terry, C-J Tsai, E Uberbacher, P Unneberg, J Vahala, K Wall, S Wessler, G Yang, T Yin, C Douglas, M Marra, G Sandberg, Y Van de Peer, D Rokhsar
The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
Science: 2006, 313(5793);1596-604
PubMed:16973872 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox