PRGDB00062374 (tir-nbs-lrr resistance protein)

From PRG Wiki
Jump to: navigation, search
tir-nbs-lrr resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 116047829 (CM000349)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa linkage group XIII, whole genome shotgun sequence.

DNA Sequence

AGCTTAAAGAACGGGAGAATGAATCCTCTAGCGAACTCGAGTTGTCATTTCATTCTTATGATCAAGGAGTCAAGGTGGAGAATTGTGGTGTCCGTATGGTAAATTCTGGCCATCTTATTGTTGCAAGCAAAGAAGCAGCTTCTTCATATACTCCATCATGGCAATCACCTACTGGCCATCTTATTATAGCAAGCAAAGAAGCAGCTTCTTCATATATTGATTCTTTAGCTAATTCTTCATCTTATAGTCAATGGATGCATGATGTCTTCTTTAGCTTCAGAGGTAAGCACAATAGCAATAATTTCACTCATTTGCATACAGCTCTATTCCAGAGAGGCATTATCCGATATAAGAGACAAATAAAGTATCTAAAGAAAATTGAATCAAGTCTCGTAAGCGACATCAAAGAGTCGGGGCTGTCAATTATTATATTTGCAAGAGATTATGTTTCAACTTTGGGGTTTGGCGGATTTGTCAAGATTGATGAATTCATGAAAAAGATGAAATCGGACACTGTTTTTCCAGTTTCAACAGTTTCTTATAATGTCGAGCAATCACGGGTAGATGAACAAACAGAGAGTTACACGATTGTCTTCGACAAGGATGAAGAAGATTTCAGTGAAGATAAGGAGAAGGTACAAAGGTGGATGGATATTCTCACCGAGGTCGCCATTTCATCTGGATCGGAATCATCGAAAAGGTAAGGCTCATCTCCAAGACCTGGATTTGGTATTGCTGTTCCTGGAAATGAAATCCCAGGCTGGTTTACTCATCAAAGTAAGGAATCTTCAATTAGGGTGCAGATGCCTTCTAATTATCTGGATGGTGATGATAATGGGTGGATGGGGTTTGCTGCATGTGCTGCATTCAGTACATATGATTTTAGTTAATCTAAAAATCATCAATCTCAGCAACTCACTGTACCTAATCAATACCCCAGATTTTACTGGAATTCCAAATCTCGAGAGTCTGATTCTTGAAGGTTGTGCAAGTTTATCTGAGGTCCATCCATCATTTGGACGTCACAAGAAGCTTCAACTTGTGAATCTTGTGAACTGCTATAGTCTTAGGATTCTCCCAAGCAACCTTGAAATGGAATCATTAGAAGTTTGCACTCTCAGTAGCTGCTCAAAACTTGATAAGTTTCCTGATATAGTAGGAAACATAAACTGCTTGAGGGAGCTTCGTTTAGATGGGACTGCTATTGCAAAACTATCTTCATCATTTCATTGTTTGGCTGGTTTAGTTCTATTGAGCATGAACAATTGTAAGAACCTTGAAAGTATTCCCAGTAGCATACGTGGTTTGAAATCCCTCAAAAGACTTGATGTGTCTGACTGCTCTGAACTTAAAAACATACCAGAGAATTTGGGGGAAGTAGAAAGTTTGGAGGAGTTTGATGCAAGTGGAACTTCAATTAGACAGCCGCCAACGTCTTTTTTTCTTTTGAAGAATCTTAAAGTATTGTCTTTTAAGGGATGCAAAAGAATAGCTGTGAATCTCACAGATCAAATATTGCCTTCTTTGTCTGGTCTGTGTTCTTTAGAAGAACTGGATTTATGCGCTTGTAATCTAGGAGAAGGAGCAGTTCCTGAAGATATTGGCTGCTTATCGTCATTGAGGAGTCTAAATCTGAGCAGAAATAACTTTATTAGCCTGCCTAAAAGCATAAATCAGCTTTCTAGGCTTGAAAAGCTTGCCTTGAAGGATTGCGTGATGCTTGAATCATTGCCTGAGGTTCCCTTGAAAGTTCAAAAAGTAAAATTGGATGGTTGTTTAAAACTAAAAGAAATTCCAGATCCAATAAAGCTATGCAGTCTGAAAAGATCAGAGTTCAAATGTCTTAACTGTTGGGAACTGTATATGCATAATGGCCAAAACAACATGGGTCTGAACATGCTTGAAAAATACCTCCAGGAAAAAATACAAAGTATATTCTTGGACTTGCCCAAAGCAAAAGAGGCACAATGGAACATGACAGCCTTCTCAAAAATGACCAAACTAAGATTGCTCAAAATTCACAACGTGGATCTTTCTGAAGGACCCGAGTATCTCTCGAAGGAGTTACGATTCCTTGAATGGCATGCTTACCCTTCAAAGTCATTGCCAGCTTGTTTCCGTCCGGATGAGCTTGTTGAACTCTACATGTCTTGCAGCAGTATTGAGCAATTATGGTGCGGATGTAAGCGATGAGTCACAATCAATTAAAAAGATTGCTGAATATATACAGTGCAAACTAAGCTTCACTTTGCAAACAATTAGCAAAAATCTAGTTGGAATAGATTCTCGTCTGAAGGTATTGAATGAATATATAGACGAACAAGCAACTGATACTCTCTTTATAGGGATATGTGGAATGGGTGGCATGGGAAAGACAACTGTTGCAAGAGTCATGTATGATAGGATTCGTTGGCAATTCCAAGGCAGCTGCTTCTTAGCAAATGTGAGAGAAGTTTTTGCAGAGAAAGATGGACGGTGTCGTTTACAGGAACAACTTCTTTCCGAAATCTCAATGGAGCTTCCCACTGCACGGGATTCTTCAAGAAGGATTGATTTGATAAAGCGCAGGCTGCGGCTTAAAAAGGTTCTTCTCATTCTCGATGATGTAGATGATGAAGAACAATTACAGATGTTGGCTGCAGAGCATGGATCGTTTGGTCCAGGGAGCCGGATTATCATAACGAGCAGAAATAAACATGTGCTGGATAGCCATGGTGTTACTAGAATATACGAGGCTGATAAATTAAATGATAAAGATGCTCTTATGTTATTTAGCTGGAAAGCTTTCAAAAGAGACCAGCCTGCTGAAGATTTATCGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTAGCTCTTGAAGTCATAGGTTCGTTCTTGCATAAAAGAGGTCTGCGTGAATGGAAAAGTGCAATTGATAGAATGAATGACATTCCTGACAGGAAGATTATTGATGTTCTTCGCATTAGTTTTGATGGCCTCCATGAATTAGAGAAGAAAATATTTTTAGATATCGCTTGCTTCTTGAAGGGGATGAAAAAGGATCGTATAGCAAGGCTACTTGACAGTTGTGGGTTCCATGCAGATATTGGGATGCAGGCTCTTATTGAGAAATCCCTTATAAGCGTCTCACGAGATGAGATAAGGATGCATAATCTATTACAGAAAATGGGTGAAGAAATTGTTCGTTGTGAATCCCCTGAAGAGCCTGGAAGACGCAGTAGATTGTGCACTTACAAGGATGTCTGCGACGCACTGGAGGACAGCACATTGTTGACATGTTTGTTGCATGTGTCAGCATTTATGAGGCGCTTATGCACTTCGAGCAACGTTTGCAACACCTCCACGTTGGAAAAATAGAAAGTATATTCGTGGACTTGCCCAAAGCAAAAGAGGCACCATGGAACATGACAGCCTTCTCAAAAATGACCAAACTAAGATTGCTCAAAATTCACAACGTGGATCTTTCTGAAGGACCTGAGTATCTCTCAAACGAGTTACGATTCCTTGAATGGCATGCTTACCCTTCGAAGTCATTGCCAGCTTGTTTCCGTCTGGATGACCTTGTTGAACTCTACATGTCTTGCAGCAGTATTGAGCAATTATGGTGCGGGTGTAAGGGACGAGTCACAATCAATTAAAAAGATTGTTGAATATATACAGTGCAAACTAAGCTTCACTTTGCCAACAATTAGCAAAAATCTAGTTGGAATAGATTCTCGTCTGAAGGTATTGAATGAATATATAGACGAACAAGCAAATGATACTCTCTTTATAGGGATATGTGGAATGGGTGGCATGGGAAAGACAACTGTTGCAAGAGTCCTGTATGATAGGATTCGTTGGCAATTCGGTGGCAGCTGCTTCTTAGCAAATGTGAGAGAAGTTTTTGCAGAGAAAGATGGACTGTGTCGTTTACAGGAACAACTTCTTTCGGAAATCTCAATGGAGCTTCCCACTGCACGGGATTCTTCAAGAAGGATTGATTTGATAAAGCGCAGGCTGCGGCTTAAAAAGGTTCTTCTTATTCTCGATGATGTAGATGATGAAGAACAATTACAGATGTTGGCTGCAGAGCATGGAACGTTTGGTCCAGGGAGCCGGATTATCATAACGAGCAGAAATAAACATGTGCTGGATAGCCATGGTGTTACTAGAATATACGAGGCTGATAAATTAAATGATAAAGATGCTCTTATGTTATTTAGCTGGAAAGCTTTCAAAAGAGACCAGCCTGCTGAAGATTTATCGGAACTATCCAAGCAAGTTGTGGGTTATGCTAATGGCCTTCCACTAGCTCTTGAAGTCATAGGTTCGTTCTTGCATAAAAGAGGTCTGCGTGAATGGAAAAGTGCAATTGATAGAATGAATGACATTCCTGACAGGAAGATTATTGATGTTCTTCGCATTAGTTTTGATGGCCTCCATGAATTAGAGAAGAAAATATTTTTAGATATCGCTTGCTTCTTGAAGGGGATGAAAAAGGATCGTATAACAAGGCTACTTGACAGTTGTGGGTTCCATGCAGATATTGGGATGCAGGCTCTTATTGAGAAATCCCTTATAAGAGTCTCACGAGATGAGATAAGGATGCATAATTTATTACAGAAAATGGGTGAAGAAATTGTTCGTTGTGAATCCCCGGAAGAGCCTGGAAGACGCAGTAGATTGTGCACGTACAAGGATGTCTGCGACGCACTGAAGGACAGCACAATGGCCTCATCCAGCATGCAGAAAGCAGCCTCATCTTCTTATTCTCCTCCCCAATGGAAGTACGATGTCTTCCTTAGTTTTAGAGGCAAAGACACACGGAATAACTTTACTAGCCATCTATATTCTAATTTGGAACAAAGAGGCATCGATGTATACATGGATGATAGGGGGCTAGAGAGAGGAAAGACCATCGAACCTGCTCTCTGGCAGGCCATCGAAGATTCAAGATTTTCAATCGTTGTGTTTTCAAGAGATTACGCGTCTTCACCATGGTGCTTAGATGAGCTTGTCAAGATTGTTCAGTGCATGAAAGAGATGGGGCACACTGTTCTACCAGTTTTTTATGATGTGGATCCATCAGAGGTAGCCGATCAGAAAGGGAATTATAAGAAGGCTTTCATTGAGCATAAGGAAAAGCACTCGGGAAATCTGGACAAGGTAAAATGCTGGAGTGATTGTCTCTCCACAGTGGCCAATCTATCTGGTTGGGATGTACGGAACAG


Protein sequences

Name Description Sequence
tir-nbs-lrr resistance protein tir-nbs-lrr resistance protein [Populus trichocarpa].

MASSSMQKAASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANLSGWDVRNRDESQSIKKIVEYIQCKLSFTLPTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGFHADIGMQALIEKSLIRVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNYLDGDDNGWMGFAACAAFSTYELKERENESSSELELSFHSYDQGVKVENCGVRMVNSGHLIVASKEAASSYTPSWQSPTGHLIIASKEAASSYIDSLANSSSYSQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAISSGSESSKR

tir-nbs-lrr resistance protein tir-nbs-lrr resistance protein [Populus trichocarpa].

MASSSMQKAASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANLSGWDVRNRDESQSIKKIVEYIQCKLSFTLPTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGFHADIGMQALIEKSLIRVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNYLDGDDNGWMGFAACAAFSTYELKERENESSSELELSFHSYDQGVKVENCGVRMVNSGHLIVASKEAASSYTPSWQSPTGHLIIASKEAASSYIDSLANSSSYSQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAISSGSESSKR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
9-163 TIR
Toll-Interleukin receptor

AASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANLSGW

superfamily: SSF52200
IPR000157
9-163 TIR
Toll-Interleukin receptor

AASSSYSPPQWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANLSGW

Gene3D: G3DSA:3.40.50.10140
18-138 G3DSA:3.40.50.10140

QWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKE

Gene3D: G3DSA:3.40.50.10140
18-138 G3DSA:3.40.50.10140

QWKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKE

ProfileScan: PS50104
IPR000157
19-160 TIR
Toll-Interleukin receptor

WKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANL

ProfileScan: PS50104
IPR000157
19-160 TIR
Toll-Interleukin receptor

WKYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANL

HMMSmart: SM00255
IPR000157
20-160 TIR
Toll-Interleukin receptor

KYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANL

HMMSmart: SM00255
IPR000157
20-160 TIR
Toll-Interleukin receptor

KYDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCLSTVANL

HMMPfam: PF01582
IPR000157
23-154 TIR
Toll-Interleukin receptor

VFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCL

HMMPfam: PF01582
IPR000157
23-154 TIR
Toll-Interleukin receptor

VFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRGLERGKTIEPALWQAIEDSRFSIVVFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKHSGNLDKVKCWSDCL

superfamily: SSF52540
179-425 SSF52540

EYIQCKLSFTLPTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKI

superfamily: SSF52540
179-425 SSF52540

EYIQCKLSFTLPTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKI

Gene3D: G3DSA:3.40.50.300
190-342 G3DSA:3.40.50.300

PTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDS

Gene3D: G3DSA:3.40.50.300
190-342 G3DSA:3.40.50.300

PTISKNLVGIDSRLKVLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDS

HMMPfam: PF00931
IPR002182
205-468 NB-ARC,NBS
NB-ARC

VLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGF

HMMPfam: PF00931
IPR002182
205-468 NB-ARC,NBS
NB-ARC

VLNEYIDEQANDTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGF

HMMSmart: SM00382
IPR003593
216-360 AAA,NBS
ATPase, AAA+ type, core

DTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDAL

HMMSmart: SM00382
IPR003593
216-360 AAA,NBS
ATPase, AAA+ type, core

DTLFIGICGMGGMGKTTVARVLYDRIRWQFGGSCFLANVREVFAEKDGLCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGTFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDAL

superfamily: SSF46785
423-529 SSF46785

RKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGFHADIGMQALIEKSLIRVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALK

superfamily: SSF46785
423-529 SSF46785

RKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRITRLLDSCGFHADIGMQALIEKSLIRVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALK

superfamily: SSF52058
503-627 SSF52058,LRR

IVRCESPEEPGRRSRLCTYKDVCDALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCL

superfamily: SSF52058
503-627 SSF52058,LRR

IVRCESPEEPGRRSRLCTYKDVCDALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCL

HMMPanther: PTHR11017:SF20
526-1487 PTHR11017:SF20,SUBFAMILY NOT NAMED

DALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNY

HMMPanther: PTHR11017
526-1487 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNY

HMMPanther: PTHR11017:SF20
526-1487 PTHR11017:SF20,SUBFAMILY NOT NAMED

DALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNY

HMMPanther: PTHR11017
526-1487 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DALKDSTGKIESIFVDLPKAKEAPWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLWCGCKLLTCLLHVSAFMRRLCTSSNVCNTSTFDESQSIKKIAEYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLNCWELYMHNGQNNMGLNMLEKYLQGSSPRPGFGIAVPGNEIPGWFTHQSKESSIRVQMPSNY

Gene3D: G3DSA:3.80.10.10
553-618 G3DSA:3.80.10.10

TAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLW

Gene3D: G3DSA:3.80.10.10
553-618 G3DSA:3.80.10.10

TAFSKMTKLRLLKIHNVDLSEGPEYLSNELRFLEWHAYPSKSLPACFRLDDLVELYMSCSSIEQLW

superfamily: SSF52540
660-906 SSF52540

EYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKI

superfamily: SSF52540
660-906 SSF52540

EYIQCKLSFTLQTISKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKI

Gene3D: G3DSA:3.40.50.300
674-824 G3DSA:3.40.50.300

SKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSH

Gene3D: G3DSA:3.40.50.300
674-824 G3DSA:3.40.50.300

SKNLVGIDSRLKVLNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSH

HMMPfam: PF00931
IPR002182
687-949 NB-ARC,NBS
NB-ARC

LNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGF

HMMPfam: PF00931
IPR002182
687-949 NB-ARC,NBS
NB-ARC

LNEYIDEQATDTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDALMLFSWKAFKRDQPAEDLSELSKQVVGYANGLPLALEVIGSFLHKRGLREWKSAIDRMNDIPDRKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGF

HMMSmart: SM00382
IPR003593
697-841 AAA,NBS
ATPase, AAA+ type, core

DTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDAL

HMMSmart: SM00382
IPR003593
697-841 AAA,NBS
ATPase, AAA+ type, core

DTLFIGICGMGGMGKTTVARVMYDRIRWQFQGSCFLANVREVFAEKDGRCRLQEQLLSEISMELPTARDSSRRIDLIKRRLRLKKVLLILDDVDDEEQLQMLAAEHGSFGPGSRIIITSRNKHVLDSHGVTRIYEADKLNDKDAL

FPrintScan: PR00364
IPR000767
700-715 DISEASERSIST
Disease resistance protein

FIGICGMGGMGKTTVA

FPrintScan: PR00364
IPR000767
700-715 DISEASERSIST
Disease resistance protein

FIGICGMGGMGKTTVA

FPrintScan: PR00364
IPR000767
776-790 DISEASERSIST
Disease resistance protein

RLRLKKVLLILDDVD

FPrintScan: PR00364
IPR000767
776-790 DISEASERSIST
Disease resistance protein

RLRLKKVLLILDDVD

FPrintScan: PR00364
IPR000767
869-883 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

FPrintScan: PR00364
IPR000767
869-883 DISEASERSIST
Disease resistance protein

ANGLPLALEVIGSFL

superfamily: SSF46785
904-1010 SSF46785

RKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALE

superfamily: SSF46785
904-1010 SSF46785

RKIIDVLRISFDGLHELEKKIFLDIACFLKGMKKDRIARLLDSCGFHADIGMQALIEKSLISVSRDEIRMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALE

superfamily: SSF52058
972-1426 SSF52058,LRR

RMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLN

superfamily: SSF52058
972-1426 SSF52058,LRR

RMHNLLQKMGEEIVRCESPEEPGRRSRLCTYKDVCDALEDSTEKIQSIFLDLPKAKEAQWNMTAFSKMTKLRLLKIHNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVCTLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPLKVQKVKLDGCLKLKEIPDPIKLCSLKRSEFKCLN

Gene3D: G3DSA:3.80.10.10
1032-1047 G3DSA:3.80.10.10

NMTAFSKMTKLRLLKI

Gene3D: G3DSA:3.80.10.10
1032-1047 G3DSA:3.80.10.10

NMTAFSKMTKLRLLKI

Gene3D: G3DSA:3.80.10.10
1048-1181 G3DSA:3.80.10.10

HNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVC

Gene3D: G3DSA:3.80.10.10
1048-1181 G3DSA:3.80.10.10

HNVDLSEGPEYLSKELRFLEWHAYPSKSLPACFRPDELVELYMSCSSIEQLWCGCKILVNLKIINLSNSLYLINTPDFTGIPNLESLILEGCASLSEVHPSFGRHKKLQLVNLVNCYSLRILPSNLEMESLEVC

Gene3D: G3DSA:3.80.10.10
1182-1392 G3DSA:3.80.10.10

TLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPL

Gene3D: G3DSA:3.80.10.10
1182-1392 G3DSA:3.80.10.10

TLSSCSKLDKFPDIVGNINCLRELRLDGTAIAKLSSSFHCLAGLVLLSMNNCKNLESIPSSIRGLKSLKRLDVSDCSELKNIPENLGEVESLEEFDASGTSIRQPPTSFFLLKNLKVLSFKGCKRIAVNLTDQILPSLSGLCSLEELDLCACNLGEGAVPEDIGCLSSLRSLNLSRNNFISLPKSINQLSRLEKLALKDCVMLESLPEVPL

ProfileScan: PS51450
IPR001611
1201-1222 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

CLRELRLDGTAIAKLSSSFHCL

ProfileScan: PS51450
IPR001611
1201-1222 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

CLRELRLDGTAIAKLSSSFHCL

FPrintScan: PR00364
IPR000767
1244-1260 DISEASERSIST
Disease resistance protein

RGLKSLKRLDVSDCSEL

FPrintScan: PR00364
IPR000767
1244-1260 DISEASERSIST
Disease resistance protein

RGLKSLKRLDVSDCSEL

ProfileScan: PS51450
IPR001611
1349-1370 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRSLNLSRNNFISLPKSINQL

ProfileScan: PS51450
IPR001611
1349-1370 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRSLNLSRNNFISLPKSINQL

superfamily: SSF52200
IPR000157
1582-1736 TIR
Toll-Interleukin receptor

SLANSSSYSQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAISSGS

superfamily: SSF52200
IPR000157
1582-1736 TIR
Toll-Interleukin receptor

SLANSSSYSQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAISSGS

Gene3D: G3DSA:3.40.50.10140
1590-1725 G3DSA:3.40.50.10140

SQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMD

Gene3D: G3DSA:3.40.50.10140
1590-1725 G3DSA:3.40.50.10140

SQWMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMD

ProfileScan: PS50104
IPR000157
1592-1733 TIR
Toll-Interleukin receptor

WMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAIS

ProfileScan: PS50104
IPR000157
1592-1733 TIR
Toll-Interleukin receptor

WMHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAIS

HMMSmart: SM00255
IPR000157
1593-1733 TIR
Toll-Interleukin receptor

MHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAIS

HMMSmart: SM00255
IPR000157
1593-1733 TIR
Toll-Interleukin receptor

MHDVFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILTEVAIS

HMMPfam: PF01582
IPR000157
1596-1728 TIR
Toll-Interleukin receptor

VFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILT

HMMPfam: PF01582
IPR000157
1596-1728 TIR
Toll-Interleukin receptor

VFFSFRGKHNSNNFTHLHTALFQRGIIRYKRQIKYLKKIESSLVSDIKESGLSIIIFARDYVSTLGFGGFVKIDEFMKKMKSDTVFPVSTVSYNVEQSRVDEQTESYTIVFDKDEEDFSEDKEKVQRWMDILT


List of References

G A Tuskan, S Difazio, S Jansson, J Bohlmann, I Grigoriev, U Hellsten, N Putnam, S Ralph, S Rombauts, A Salamov, J Schein, L Sterck, A Aerts, R R Bhalerao, R P Bhalerao, D Blaudez, W Boerjan, A Brun, A Brunner, V Busov, M Campbell, J Carlson, M Chalot, J Chapman, G-L Chen, D Cooper, P M Coutinho, J Couturier, S Covert, Q Cronk, R Cunningham, J Davis, S Degroeve, A Déjardin, C Depamphilis, J Detter, B Dirks, I Dubchak, S Duplessis, J Ehlting, B Ellis, K Gendler, D Goodstein, M Gribskov, J Grimwood, A Groover, L Gunter, B Hamberger, B Heinze, Y Helariutta, B Henrissat, D Holligan, R Holt, W Huang, N Islam-Faridi, S Jones, M Jones-Rhoades, R Jorgensen, C Joshi, J Kangasjärvi, J Karlsson, C Kelleher, R Kirkpatrick, M Kirst, A Kohler, U Kalluri, F Larimer, J Leebens-Mack, J-C Leplé, P Locascio, Y Lou, S Lucas, F Martin, B Montanini, C Napoli, D R Nelson, C Nelson, K Nieminen, O Nilsson, V Pereda, G Peter, R Philippe, G Pilate, A Poliakov, J Razumovskaya, P Richardson, C Rinaldi, K Ritland, P Rouzé, D Ryaboy, J Schmutz, J Schrader, B Segerman, H Shin, A Siddiqui, F Sterky, A Terry, C-J Tsai, E Uberbacher, P Unneberg, J Vahala, K Wall, S Wessler, G Yang, T Yin, C Douglas, M Marra, G Sandberg, Y Van de Peer, D Rokhsar
The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
Science: 2006, 313(5793);1596-604
PubMed:16973872 WorldCat.org DOI (I p)

G A Tuskan, S Difazio, S Jansson, J Bohlmann, I Grigoriev, U Hellsten, N Putnam, S Ralph, S Rombauts, A Salamov, J Schein, L Sterck, A Aerts, R R Bhalerao, R P Bhalerao, D Blaudez, W Boerjan, A Brun, A Brunner, V Busov, M Campbell, J Carlson, M Chalot, J Chapman, G-L Chen, D Cooper, P M Coutinho, J Couturier, S Covert, Q Cronk, R Cunningham, J Davis, S Degroeve, A Déjardin, C Depamphilis, J Detter, B Dirks, I Dubchak, S Duplessis, J Ehlting, B Ellis, K Gendler, D Goodstein, M Gribskov, J Grimwood, A Groover, L Gunter, B Hamberger, B Heinze, Y Helariutta, B Henrissat, D Holligan, R Holt, W Huang, N Islam-Faridi, S Jones, M Jones-Rhoades, R Jorgensen, C Joshi, J Kangasjärvi, J Karlsson, C Kelleher, R Kirkpatrick, M Kirst, A Kohler, U Kalluri, F Larimer, J Leebens-Mack, J-C Leplé, P Locascio, Y Lou, S Lucas, F Martin, B Montanini, C Napoli, D R Nelson, C Nelson, K Nieminen, O Nilsson, V Pereda, G Peter, R Philippe, G Pilate, A Poliakov, J Razumovskaya, P Richardson, C Rinaldi, K Ritland, P Rouzé, D Ryaboy, J Schmutz, J Schrader, B Segerman, H Shin, A Siddiqui, F Sterky, A Terry, C-J Tsai, E Uberbacher, P Unneberg, J Vahala, K Wall, S Wessler, G Yang, T Yin, C Douglas, M Marra, G Sandberg, Y Van de Peer, D Rokhsar
The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
Science: 2006, 313(5793);1596-604
PubMed:16973872 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox