PRGDB00062444 (unnamed protein product)

From PRG Wiki
Jump to: navigation, search
unnamed protein product
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 312282122 (AK352841)
Gene Class Unknown
Domain Type LRR
Gene Species Eutrema halophilum

Comment?

Thellungiella halophila mRNA, complete cds, clone: RTFL01-11-D14.

DNA Sequence

ATGAACACTTCTTCCTCTTCTTCTTCCTTCCCTCTCTTTATCTTCGCCGCCATTATCTTTCTCCGGTGCCTAAACCCCACCGGAGCCGCCACGTGTCATCCAGATGACGAGGCGGGTCTTCTAGCATTCAAAGCGGGTATAACCCGAGATCCTTCGGGTATTCTCAGCTCATGGAAGAAAGGTACTGCTTGCTGCTCATGGAACGGTGTCACTTGTCTCACCGGCGATCGCGTCACCGCACTCACCGTCGCCGGACAGTCTGATGTCGCCGGAAGTTTCCTCTCCGGCACTATCTCTCCGTCGTTAGCCAAACTCCAACACCTCGACGGAATTTACTTCACCGATCTCAAAAACATCACCGGATCTTTCCCCCAGTTCCTTTTCCGATTACCAAAGCTTATATACGTTTACATCGAGAATAACCGTCTCTCCGGTCCTCTTCCGGTTAACATCGGTTCGTTAAGCCAATTCGAAGCGTTTAGTCTCGAGGGAAACCGGTTCACGGGTCCAATCCCGAGTTCGATTTCGAATTTAACTCGGTTATCGCAGCTCAATCTCGGCAATAATCTCTTAACCGGAACTATCCCTTTAGGGATTGCTAATCTCAAGCTCATGTCGTCTCTAAATCTCGGCGGTAACCGTCTCACCGGAACAATCCCGGATGTTTTCAAATCCATGACGGAGCTCCGATCGCTAACTCTCTCTCGCAACAGATTTTCCGGTAATCTCCCGCCGTCGATCGCGTCTCTCTCGCCGATTCTCAGGTTCCTCGAGTTAGGCCAGAACAATCTCTCCGGTACCATCCCGAGCTATTTATCGAGATTCAAAGCCCTCGATACATTGGATCTCTCAAGGAATCGATTCTCTGGAATCGTACCCAAGAGCTTCGCGAATCTCACAAAAATCTTCAATCTCGATCTCTCACACAATCTCCTAACCGATCCGTTCCCTGAATTGTTCGTGAAAGGAATCGAATCTCTTGATCTATCGTACAATCAATTTCACCTGAAAATGATTCCAAAATGGGTGACTTCGTCGCCGATCATCTTCTCGTTGAAGCTAGCGAAATGCGGAATCAAGATGAGATTTGACGATTGGAAGCCTGCAGAGACTTACTTCTACGATTTCATCGATCTCTCGGAAAACGAGATCTCAGGGAGTCCGGCGAGGTTTCTGAACCAGACGGAGTATCTTGTGGAGTTCCGTGCGGCGGGGAATAAACTCCGATTTGATATGGGGAAGCTGAAGTTTGCGAAGACACTGAAAACTCTTGATTTGTCGAGGAACTTGGTGTTTGGGAAGGTGCCTGCGACGGTGGCTGGATTGAAGACACTGAACGTGAGTCGGAATCATCTTTGCGGAAAGCTTCCGGCGACAAAGTTTCCGGCTAGTGCGTTCGCCGGTAATGACTGTCTCTGCGGGTCTCCACTTTCTCCTTGTAAAGTTTAA


Protein sequences

Name Description Sequence
unnamed protein product unnamed protein product [Thellungiella halophila].

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSPCKV

unnamed protein product unnamed protein product [Thellungiella halophila].

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSPCKV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-479 PTHR24420,FAMILY NOT NAMED

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-479 PTHR24420:SF510

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420
1-479 PTHR24420,FAMILY NOT NAMED

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-479 PTHR24420:SF510

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

Gene3D: G3DSA:3.80.10.10
31-251 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLS

Gene3D: G3DSA:3.80.10.10
31-251 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLS

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

superfamily: SSF52058
63-454 SSF52058,LRR

ACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCG

superfamily: SSF52058
63-454 SSF52058,LRR

ACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCG

HMMPfam: PF00560
IPR001611
207-225 LRR_1
Leucine-rich repeat

SLNLGGNRLTGTIPDVFKS

HMMPfam: PF00560
IPR001611
207-225 LRR_1
Leucine-rich repeat

SLNLGGNRLTGTIPDVFKS

HMMPfam: PF00560
IPR001611
229-250 LRR_1
Leucine-rich repeat

LRSLTLSRNRFSGNLPPSIASL

HMMPfam: PF00560
IPR001611
229-250 LRR_1
Leucine-rich repeat

LRSLTLSRNRFSGNLPPSIASL

Gene3D: G3DSA:3.80.10.10
254-479 G3DSA:3.80.10.10

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

Gene3D: G3DSA:3.80.10.10
254-479 G3DSA:3.80.10.10

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPfam: PF13855
254-312 LRR_8,Leucine rich repeat

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLL

HMMPfam: PF13855
254-312 LRR_8,Leucine rich repeat

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLL

HMMPfam: PF00560
IPR001611
442-461 LRR_1
Leucine-rich repeat

LKTLNVSRNHLCGKLPATKF

HMMPfam: PF00560
IPR001611
442-461 LRR_1
Leucine-rich repeat

LKTLNVSRNHLCGKLPATKF


List of References

Teruaki Taji, Tetsuya Sakurai, Keiichi Mochida, Atsushi Ishiwata, Atsushi Kurotani, Yasushi Totoki, Atsushi Toyoda, Yoshiyuki Sakaki, Motoaki Seki, Hirokazu Ono, Yoichi Sakata, Shigeo Tanaka, Kazuo Shinozaki
Large-scale collection and annotation of full-length enriched cDNAs from a model halophyte, Thellungiella halophila.
BMC Plant Biol.: 2008, 8();115
PubMed:19014467 WorldCat.org DOI (I e)

Teruaki Taji, Kenji Komatsu, Taku Katori, Yoshikazu Kawasaki, Yoichi Sakata, Shigeo Tanaka, Masatomo Kobayashi, Atsushi Toyoda, Motoaki Seki, Kazuo Shinozaki
Comparative genomic analysis of 1047 completely sequenced cDNAs from an Arabidopsis-related model halophyte, Thellungiella halophila.
BMC Plant Biol.: 2010, 10();261
PubMed:21106055 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox