PRGDB00062444 (unnamed protein product)

From PRG Wiki
Jump to: navigation, search
unnamed protein product
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 312282122 (AK352841)
Gene Class Unknown
Domain Type LRR
Gene Species Eutrema halophilum

Comment?

Thellungiella halophila mRNA, complete cds, clone: RTFL01-11-D14.

DNA Sequence

ATGAACACTTCTTCCTCTTCTTCTTCCTTCCCTCTCTTTATCTTCGCCGCCATTATCTTTCTCCGGTGCCTAAACCCCACCGGAGCCGCCACGTGTCATCCAGATGACGAGGCGGGTCTTCTAGCATTCAAAGCGGGTATAACCCGAGATCCTTCGGGTATTCTCAGCTCATGGAAGAAAGGTACTGCTTGCTGCTCATGGAACGGTGTCACTTGTCTCACCGGCGATCGCGTCACCGCACTCACCGTCGCCGGACAGTCTGATGTCGCCGGAAGTTTCCTCTCCGGCACTATCTCTCCGTCGTTAGCCAAACTCCAACACCTCGACGGAATTTACTTCACCGATCTCAAAAACATCACCGGATCTTTCCCCCAGTTCCTTTTCCGATTACCAAAGCTTATATACGTTTACATCGAGAATAACCGTCTCTCCGGTCCTCTTCCGGTTAACATCGGTTCGTTAAGCCAATTCGAAGCGTTTAGTCTCGAGGGAAACCGGTTCACGGGTCCAATCCCGAGTTCGATTTCGAATTTAACTCGGTTATCGCAGCTCAATCTCGGCAATAATCTCTTAACCGGAACTATCCCTTTAGGGATTGCTAATCTCAAGCTCATGTCGTCTCTAAATCTCGGCGGTAACCGTCTCACCGGAACAATCCCGGATGTTTTCAAATCCATGACGGAGCTCCGATCGCTAACTCTCTCTCGCAACAGATTTTCCGGTAATCTCCCGCCGTCGATCGCGTCTCTCTCGCCGATTCTCAGGTTCCTCGAGTTAGGCCAGAACAATCTCTCCGGTACCATCCCGAGCTATTTATCGAGATTCAAAGCCCTCGATACATTGGATCTCTCAAGGAATCGATTCTCTGGAATCGTACCCAAGAGCTTCGCGAATCTCACAAAAATCTTCAATCTCGATCTCTCACACAATCTCCTAACCGATCCGTTCCCTGAATTGTTCGTGAAAGGAATCGAATCTCTTGATCTATCGTACAATCAATTTCACCTGAAAATGATTCCAAAATGGGTGACTTCGTCGCCGATCATCTTCTCGTTGAAGCTAGCGAAATGCGGAATCAAGATGAGATTTGACGATTGGAAGCCTGCAGAGACTTACTTCTACGATTTCATCGATCTCTCGGAAAACGAGATCTCAGGGAGTCCGGCGAGGTTTCTGAACCAGACGGAGTATCTTGTGGAGTTCCGTGCGGCGGGGAATAAACTCCGATTTGATATGGGGAAGCTGAAGTTTGCGAAGACACTGAAAACTCTTGATTTGTCGAGGAACTTGGTGTTTGGGAAGGTGCCTGCGACGGTGGCTGGATTGAAGACACTGAACGTGAGTCGGAATCATCTTTGCGGAAAGCTTCCGGCGACAAAGTTTCCGGCTAGTGCGTTCGCCGGTAATGACTGTCTCTGCGGGTCTCCACTTTCTCCTTGTAAAGTTTAA


Protein sequences

Name Description Sequence
unnamed protein product unnamed protein product [Thellungiella halophila].

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSPCKV

unnamed protein product unnamed protein product [Thellungiella halophila].

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSPCKV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-479 PTHR24420,FAMILY NOT NAMED

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-479 PTHR24420:SF510

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420
1-479 PTHR24420,FAMILY NOT NAMED

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-479 PTHR24420:SF510

MNTSSSSSSFPLFIFAAIIFLRCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

Gene3D: G3DSA:3.80.10.10
31-251 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLS

Gene3D: G3DSA:3.80.10.10
31-251 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLS

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

superfamily: SSF52058
63-454 SSF52058,LRR

ACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCG

superfamily: SSF52058
63-454 SSF52058,LRR

ACCSWNGVTCLTGDRVTALTVAGQSDVAGSFLSGTISPSLAKLQHLDGIYFTDLKNITGSFPQFLFRLPKLIYVYIENNRLSGPLPVNIGSLSQFEAFSLEGNRFTGPIPSSISNLTRLSQLNLGNNLLTGTIPLGIANLKLMSSLNLGGNRLTGTIPDVFKSMTELRSLTLSRNRFSGNLPPSIASLSPILRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCG

HMMPfam: PF00560
IPR001611
207-225 LRR_1
Leucine-rich repeat

SLNLGGNRLTGTIPDVFKS

HMMPfam: PF00560
IPR001611
207-225 LRR_1
Leucine-rich repeat

SLNLGGNRLTGTIPDVFKS

HMMPfam: PF00560
IPR001611
229-250 LRR_1
Leucine-rich repeat

LRSLTLSRNRFSGNLPPSIASL

HMMPfam: PF00560
IPR001611
229-250 LRR_1
Leucine-rich repeat

LRSLTLSRNRFSGNLPPSIASL

Gene3D: G3DSA:3.80.10.10
254-479 G3DSA:3.80.10.10

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

Gene3D: G3DSA:3.80.10.10
254-479 G3DSA:3.80.10.10

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLLTDPFPELFVKGIESLDLSYNQFHLKMIPKWVTSSPIIFSLKLAKCGIKMRFDDWKPAETYFYDFIDLSENEISGSPARFLNQTEYLVEFRAAGNKLRFDMGKLKFAKTLKTLDLSRNLVFGKVPATVAGLKTLNVSRNHLCGKLPATKFPASAFAGNDCLCGSPLSP

HMMPfam: PF13855
254-312 LRR_8,Leucine rich repeat

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLL

HMMPfam: PF13855
254-312 LRR_8,Leucine rich repeat

LRFLELGQNNLSGTIPSYLSRFKALDTLDLSRNRFSGIVPKSFANLTKIFNLDLSHNLL

HMMPfam: PF00560
IPR001611
442-461 LRR_1
Leucine-rich repeat

LKTLNVSRNHLCGKLPATKF

HMMPfam: PF00560
IPR001611
442-461 LRR_1
Leucine-rich repeat

LKTLNVSRNHLCGKLPATKF


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox