PRGDB00062459 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 300145810 (GL377638)
Gene Class Unknown
Domain Type LRR
Gene Species Selaginella moellendorffii

Comment?

Selaginella moellendorffii unplaced genomic scaffold SELMOscaffold_73, whole genome shotgun sequence.

DNA Sequence

TGAAAAAGAAAACGCAGTTTGTCACTGCGGCTTGTACGAAGATCTGCTTATTGGAGAGGATCAAGTAGGATGAATGGCATTCTGTGACATGCTGATGCTGCTGCTGCTGCTCCTGCCAGTCAGACAAGCTTTGACTATCAATCACAGTGACCACCAAATGCAGGCTTTGCTCAACTTCAAGTCCGGGATCACTGCTGATGCTTCAGGAGTCCTGGCGAACTGGACGCGCAAGAAGAAAGCTTCTTTGTGTTCTTCGAGCTGGAGCGGAATAATCTGTGACTCTGACAATCTCAGTGTTGTGGGTATCAATCTCTCCAACTGCATGCTTCAAGGTACGATCCTCCCTTCTTCTCTTGGAAGCATTGGTAGCTTGAAAGTTCTGAATCTGAGTCGAAACAACCTGTCGGGGAAGATACCACTTGACTTCGGCCAGTTGAAAAATCTGAGGACTCTGGCGCTGAACTTCAATGAGCTCGAGGGCCAAATTCCAGAAGAGCTTGGAACCATCCAAGAGTTGACATATCTCAACCTCGGGTACAACAAACTTCGCGGTGGAATACCTGCTATGCTCGGACACCTCAAGAAGCTCGAAACTCTGGCACTCCACATGAACAATCTCACCAACATCATTCCCAGGGAACTCAGCAACTGTAGCAATCTTCAGGTGCTTGTTCTCCAGGCCAACATGCTGGAGGGTTCAATTCCACCAGAGTTAGGAGTGTTGCCCCAGCTGGAGCTGATTGCCTTGGGTAGCAATCACTTGTCAGGAAGTTTACCAGCTTCTCTTGGGAATTGTACCAACATGCAGGAGATCTGGCTGGGAGTCAACAGCTTGAAGGGTCCAATTCCAGAAGAGCTTGGACGATTGAAGAATCTTCAGGTGCTGCATCTGGAGCAAAACCAGCTGGACGGACATATTCCACTGGCCATCGCTAATTGCTCAATGCTCATCGAGCTGTTTCTGGGAGGAAATTCCCTGAGTGGACAGATTCCAAGTTCCTTCGGTCAGCTTCAGAACATGCAAGCCCTCTCCCTGTATGGATCCCAAAGGCTCACCGGCAAGATCCCAGAAGAGCTAGGCAATTGCAGCCAGCTAGAATGGTTGGATATCGGCTGGTCCCCCAATCTGGATGGTCCTATCCCATCATCATTGTTTCGGCTTCCGCTAACCACATTGGCTTTGGCTGAACTCGGACTGACGAAGAACAACACCGGCACTTTATCACCAAGGATTGGCAACGTAACAACGCTGACCAATCTAGACCTGGGAATTTGTACTTTCCGAGGAAGCATTCCCAAGGAGCTGGCAAATCTGACAGCGCTTGAGCGTTTGAATCTAGGATCCAATCTGTTTGACGGAGAAATTCCACAAGATCTGGGACGACTCATTAATCTGCAGCACTTATTCCTTGATACGAACAACTTGCATGGAGCCGTACCACAGTCGATCACAAGCTTGAGCAAGCTCCAGGATTTGTTCATTCACAGGAACTCTCTGTCCGGAAGGATTTCCCACCTGTCATTCGAAAACTGGACACAGATGACAGATCTGAGGATGCACGAAAACAAATTCACAGGCTCAATACCTGAGTCACTTGGCGACCTTTCCCAGCTCCAAATTCTCTATATGTTTAGTAATAGCTTCAGCGGGACAGTCCCCTCCATCGTCGGGAAGCTTCAGAAGTTGACTCAAATGGATCTATCCAAGAATCTGCTCATTGGAGAAATTCCTCGAAGCCTTGGGAACTGCAGTTCATTGAAGCAGTTGGACCTGTCAAAGAATGCCATTAGTGGAAGAGTCCCGGATGAAATTGGTACAATATGCAAAAGCCTTCAAGCACTGGGAGTAGAAGGAAACAAACTGACTGGGAACCTTCCGGTTACCTTGGAGAACTGCACCTTGTTGGAGCGCCTTAAGGTTGGGAATAACTCACTGAAGGGAGAGCTTGGTATGAACATTTCGAAGTTGTCCTCTTTGAAGATCCTCTCGCTCTCACTCAACAATTTCCAAGGCCAGTTTCCACTGTTAAACGCAACTTCCATCGAGCTGATTGATCTGCGGGGGAACAGGTTTACTGGTGAGCTCCCTTCATCTCTGGGAAAGTACCAAACGCTGAGAGTGCTAAGCTTGGGGAACAACAGCTTCCGTGGTTCCTTGACATCCATGGATTGGCTGTGGAATCTCACCCAACTTCAGGTGCTCGACTTATCAAATAACCAGTTTGAAGGATCACTGCCCGCCACCCTCAACAATCTACAGGGTTTCAAGTTAACATCGGAGGGCGATGCTGCGGGTGCCGATCGACTATATCAAGACCTGTTCCTCAGTGTGAAAGGCAATTTATTTGCTCCATACCAGTACGTCTTACGCACCACGACTCTGCTGGATTTATCGACGAATCAGCTGACTGGCAAGCTTCCTGTAAGCATGGGCGACCTCGTTGGCCTTCGTTACCTTAACCTGTCCCACAACAATTTTAGTGGTGAGATTCCAAGTTCCTATGGGAAAATCACTCAACTGGAGCAGCTCGACCTGTCCTTCAACCACCTGCAAGGCTCCATTCCAACCTTACTCGCAAATCTCGACTCGCTTGCCTCCTTCAACGTGTCTTTCAATCAGCTGGAGGGTGAGATCCCGCAGAAGAAGCACTTTGACACATTCGACAACTCAAGCTTCATCGGAAATCTCGGCCTCTGTGGTCGCCCACTCTCCAAACAATGCCACGAAACAGAATCAGGAGCAGCCGGACATGTGGGAGCTGGAAGCATCTCTGAGTCGGACTCCAACGAGACCTGGTGGGAAGAAAATGTGTCACCTGTTTCTTTCGCACTGTCCTCCTCCATTAGCTTCTGCTTGTTGTGGTTGATGCTACGCTGGAGGCAGCT


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein SELMODRAFT_425288 [Selaginella moellendorffii].

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKENAVCHCGLYEDLLIGEDQVG

hypothetical protein hypothetical protein SELMODRAFT_425288 [Selaginella moellendorffii].

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKENAVCHCGLYEDLLIGEDQVG


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-942 PTHR24420,FAMILY NOT NAMED

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKEN

HMMPanther: PTHR24420:SF474
1-942 PTHR24420:SF474,SUBFAMILY NOT NAMED

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKEN

HMMPanther: PTHR24420
1-942 PTHR24420,FAMILY NOT NAMED

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKEN

HMMPanther: PTHR24420:SF474
1-942 PTHR24420:SF474,SUBFAMILY NOT NAMED

MAFCDMLMLLLLLLPVRQALTINHSDHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLSKQCHETESGAAGHVGAGSISESDSNETWWEENVSPVSFALSSSISFCLLWLMLRWRQLEKEN

HMMPfam: PF08263
IPR013210
26-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICD

HMMPfam: PF08263
IPR013210
26-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DHQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICD

Gene3D: G3DSA:3.80.10.10
27-238 G3DSA:3.80.10.10

HQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASL

Gene3D: G3DSA:3.80.10.10
27-238 G3DSA:3.80.10.10

HQMQALLNFKSGITADASGVLANWTRKKKASLCSSSWSGIICDSDNLSVVGINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASL

superfamily: SSF52047
77-381 SSF52047,LRR

GINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTG

superfamily: SSF52047
77-381 SSF52047,LRR

GINLSNCMLQGTILPSSLGSIGSLKVLNLSRNNLSGKIPLDFGQLKNLRTLALNFNELEGQIPEELGTIQELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANMLEGSIPPELGVLPQLELIALGSNHLSGSLPASLGNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRLPLTTLALAELGLTKNNTG

ProfileScan: PS51450
IPR001611
99-120 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVLNLSRNNLSGKIPLDFGQ

HMMPfam: PF00560
IPR001611
99-121 LRR_1
Leucine-rich repeat

SLKVLNLSRNNLSGKIPLDFGQL

ProfileScan: PS51450
IPR001611
99-120 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVLNLSRNNLSGKIPLDFGQ

HMMPfam: PF00560
IPR001611
99-121 LRR_1
Leucine-rich repeat

SLKVLNLSRNNLSGKIPLDFGQL

ProfileScan: PS51450
IPR001611
123-145 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRTLALNFNELEGQIPEELGTI

ProfileScan: PS51450
IPR001611
123-145 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRTLALNFNELEGQIPEELGTI

ProfileScan: PS51450
IPR001611
147-170 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELTYLNLGYNKLRGGIPAMLGHLK

ProfileScan: PS51450
IPR001611
147-170 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELTYLNLGYNKLRGGIPAMLGHLK

HMMPfam: PF13855
147-206 LRR_8,Leucine rich repeat

ELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANML

HMMPfam: PF13855
147-206 LRR_8,Leucine rich repeat

ELTYLNLGYNKLRGGIPAMLGHLKKLETLALHMNNLTNIIPRELSNCSNLQVLVLQANML

ProfileScan: PS51450
IPR001611
171-192 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLETLALHMNNLTNIIPRELSN

ProfileScan: PS51450
IPR001611
171-192 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLETLALHMNNLTNIIPRELSN

ProfileScan: PS51450
IPR001611
195-217 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLVLQANMLEGSIPPELGVL

ProfileScan: PS51450
IPR001611
195-217 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLVLQANMLEGSIPPELGVL

Gene3D: G3DSA:3.80.10.10
239-363 G3DSA:3.80.10.10

GNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRL

Gene3D: G3DSA:3.80.10.10
239-363 G3DSA:3.80.10.10

GNCTNMQEIWLGVNSLKGPIPEELGRLKNLQVLHLEQNQLDGHIPLAIANCSMLIELFLGGNSLSGQIPSSFGQLQNMQALSLYGSQRLTGKIPEELGNCSQLEWLDIGWSPNLDGPIPSSLFRL

HMMPfam: PF13516
265-288 LRR_6,Leucine Rich repeat

LKNLQVLHLEQNQLDGHIPLAIAN

HMMPfam: PF13516
265-288 LRR_6,Leucine Rich repeat

LKNLQVLHLEQNQLDGHIPLAIAN

ProfileScan: PS51450
IPR001611
267-288 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLHLEQNQLDGHIPLAIAN

ProfileScan: PS51450
IPR001611
267-288 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLHLEQNQLDGHIPLAIAN

ProfileScan: PS51450
IPR001611
291-313 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLIELFLGGNSLSGQIPSSFGQL

ProfileScan: PS51450
IPR001611
291-313 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLIELFLGGNSLSGQIPSSFGQL

HMMPfam: PF00560
IPR001611
292-313 LRR_1
Leucine-rich repeat

LIELFLGGNSLSGQIPSSFGQL

HMMPfam: PF00560
IPR001611
292-313 LRR_1
Leucine-rich repeat

LIELFLGGNSLSGQIPSSFGQL

Gene3D: G3DSA:3.80.10.10
370-590 G3DSA:3.80.10.10

LAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQAL

Gene3D: G3DSA:3.80.10.10
370-590 G3DSA:3.80.10.10

LAELGLTKNNTGTLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQAL

superfamily: SSF52047
382-692 SSF52047,LRR

TLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFR

superfamily: SSF52047
382-692 SSF52047,LRR

TLSPRIGNVTTLTNLDLGICTFRGSIPKELANLTALERLNLGSNLFDGEIPQDLGRLINLQHLFLDTNNLHGAVPQSITSLSKLQDLFIHRNSLSGRISHLSFENWTQMTDLRMHENKFTGSIPESLGDLSQLQILYMFSNSFSGTVPSIVGKLQKLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFR

ProfileScan: PS51450
IPR001611
416-439 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALERLNLGSNLFDGEIPQDLGRLI

ProfileScan: PS51450
IPR001611
416-439 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALERLNLGSNLFDGEIPQDLGRLI

ProfileScan: PS51450
IPR001611
440-462 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQHLFLDTNNLHGAVPQSITSL

ProfileScan: PS51450
IPR001611
440-462 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQHLFLDTNNLHGAVPQSITSL

ProfileScan: PS51450
IPR001611
464-486 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQDLFIHRNSLSGRISHLSFEN

ProfileScan: PS51450
IPR001611
464-486 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQDLFIHRNSLSGRISHLSFEN

ProfileScan: PS51450
IPR001611
537-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTQMDLSKNLLIGEIPRSLGNCS

ProfileScan: PS51450
IPR001611
537-560 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTQMDLSKNLLIGEIPRSLGNCS

HMMPfam: PF13855
537-597 LRR_8,Leucine rich repeat

KLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKL

HMMPfam: PF13855
537-597 LRR_8,Leucine rich repeat

KLTQMDLSKNLLIGEIPRSLGNCSSLKQLDLSKNAISGRVPDEIGTICKSLQALGVEGNKL

ProfileScan: PS51450
IPR001611
561-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKQLDLSKNAISGRVPDEIGTI

ProfileScan: PS51450
IPR001611
561-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKQLDLSKNAISGRVPDEIGTI

ProfileScan: PS51450
IPR001611
586-609 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQALGVEGNKLTGNLPVTLENCT

ProfileScan: PS51450
IPR001611
586-609 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQALGVEGNKLTGNLPVTLENCT

Gene3D: G3DSA:3.80.10.10
591-735 G3DSA:3.80.10.10

GVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTS

Gene3D: G3DSA:3.80.10.10
591-735 G3DSA:3.80.10.10

GVEGNKLTGNLPVTLENCTLLERLKVGNNSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTS

superfamily: SSF52047
619-864 SSF52047,LRR

NSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFD

superfamily: SSF52047
619-864 SSF52047,LRR

NSLKGELGMNISKLSSLKILSLSLNNFQGQFPLLNATSIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQFEGSLPATLNNLQGFKLTSEGDAAGADRLYQDLFLSVKGNLFAPYQYVLRTTTLLDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFD

ProfileScan: PS51450
IPR001611
634-655 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILSLSLNNFQGQFPLLNAT

ProfileScan: PS51450
IPR001611
634-655 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILSLSLNNFQGQFPLLNAT

HMMPfam: PF13855
656-716 LRR_8,Leucine rich repeat

SIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQ

HMMPfam: PF13855
656-716 LRR_8,Leucine rich repeat

SIELIDLRGNRFTGELPSSLGKYQTLRVLSLGNNSFRGSLTSMDWLWNLTQLQVLDLSNNQ

ProfileScan: PS51450
IPR001611
680-702 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRVLSLGNNSFRGSLTSMDWLW

ProfileScan: PS51450
IPR001611
680-702 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRVLSLGNNSFRGSLTSMDWLW

ProfileScan: PS51450
IPR001611
706-729 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQVLDLSNNQFEGSLPATLNNLQ

ProfileScan: PS51450
IPR001611
706-729 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQVLDLSNNQFEGSLPATLNNLQ

Gene3D: G3DSA:3.80.10.10
771-880 G3DSA:3.80.10.10

LDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLS

Gene3D: G3DSA:3.80.10.10
771-880 G3DSA:3.80.10.10

LDLSTNQLTGKLPVSMGDLVGLRYLNLSHNNFSGEIPSSYGKITQLEQLDLSFNHLQGSIPTLLANLDSLASFNVSFNQLEGEIPQKKHFDTFDNSSFIGNLGLCGRPLS

ProfileScan: PS51450
IPR001611
791-813 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRYLNLSHNNFSGEIPSSYGKI

ProfileScan: PS51450
IPR001611
791-813 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRYLNLSHNNFSGEIPSSYGKI

HMMPfam: PF00560
IPR001611
792-809 LRR_1
Leucine-rich repeat

LRYLNLSHNNFSGEIPSS

HMMPfam: PF00560
IPR001611
792-809 LRR_1
Leucine-rich repeat

LRYLNLSHNNFSGEIPSS

ProfileScan: PS51450
IPR001611
815-837 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEQLDLSFNHLQGSIPTLLANL

HMMPfam: PF00560
IPR001611
815-837 LRR_1
Leucine-rich repeat

QLEQLDLSFNHLQGSIPTLLANL

ProfileScan: PS51450
IPR001611
815-837 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEQLDLSFNHLQGSIPTLLANL

HMMPfam: PF00560
IPR001611
815-837 LRR_1
Leucine-rich repeat

QLEQLDLSFNHLQGSIPTLLANL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox