PRGDB00062472 (NBS-LRR-like protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7248762 (AF220737)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa NBS-LRR-like protein (YR12) gene, complete cds.

DNA Sequence

GGGGGGGTGGGGAAAACGACTCTGTCCCAACATGTTTATAATGATCCGGAAATCGGAAATCAGTTTGAGATCAAGATATGGGTCCATGTATCTGATAAATTTGATGTGGTTAGGATCACAAGGGAGATTTTAGGGTGTGTCTCCAACCGAAGTTACCAAGGAATAAGCAACTTTAACATGCTTCAGCAGGATCTTGAGAAACACATGAAATCTAAGAAGTTTCTGATTGTTTTGGATGATGTCTGGGATGTCACTACAGAAGACTGTTGGAACAAACTACTGGGTCCTTTAAGACCTAATCATGTGAATGCATCAGAAGTGACAGGTAATATGATCATTGTGACAACTCGAATACTGACTGTCGCTCAAAGGTGTGGAACGGCAGGATCAATAAATTTAGAAGCTCTGGAAGATGGTGATATATGGTCACTATTTAAAGCATATGCATTTAGTACTGATCAACATGGTAGTAATCAAAATTTAGAGAATCTTGGGAGGAAAACAATTAAGGAGCTAAAAGGCAACCCCTTCGCCGC


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Oryza sativa Japonica Group].

GGVGKTTLSQHVYNDPEIGNQFEIKIWVHVSDKFDVVRITREILGCVSNRSYQGISNFNMLQQDLEKHMKSKKFLIVLDDVWDVTTEDCWNKLLGPLRPNHVNASEVTGNMIIVTTRILTVAQRCGTAGSINLEALEDGDIWSLFKAYAFSTDQHGSNQNLENLGRKTIKELKGNPFAA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
1-100 PTHR23155:SF121,SUBFAMILY NOT NAMED

GGVGKTTLSQHVYNDPEIGNQFEIKIWVHVSDKFDVVRITREILGCVSNRSYQGISNFNMLQQDLEKHMKSKKFLIVLDDVWDVTTEDCWNKLLGPLRPN

HMMPfam: PF00931
IPR002182
1-178 NB-ARC,NBS
NB-ARC

GGVGKTTLSQHVYNDPEIGNQFEIKIWVHVSDKFDVVRITREILGCVSNRSYQGISNFNMLQQDLEKHMKSKKFLIVLDDVWDVTTEDCWNKLLGPLRPNHVNASEVTGNMIIVTTRILTVAQRCGTAGSINLEALEDGDIWSLFKAYAFSTDQHGSNQNLENLGRKTIKELKGNPFA

superfamily: SSF52540
1-172 SSF52540

GGVGKTTLSQHVYNDPEIGNQFEIKIWVHVSDKFDVVRITREILGCVSNRSYQGISNFNMLQQDLEKHMKSKKFLIVLDDVWDVTTEDCWNKLLGPLRPNHVNASEVTGNMIIVTTRILTVAQRCGTAGSINLEALEDGDIWSLFKAYAFSTDQHGSNQNLENLGRKTIKEL

HMMPanther: PTHR23155
1-100 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLSQHVYNDPEIGNQFEIKIWVHVSDKFDVVRITREILGCVSNRSYQGISNFNMLQQDLEKHMKSKKFLIVLDDVWDVTTEDCWNKLLGPLRPN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox