PRGDB00062918 (stem rust resistance protein Rpg1)

From PRG Wiki
Jump to: navigation, search
stem rust resistance protein Rpg1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21728343 (AF509747)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare subsp. vulgare stem rust resistance protein Rpg1 (Rpg1) mRNA, complete cds.

DNA Sequence

ATGATGCGAAGGATGGTGATGAAGGTGGCGCTGGAGGACAGGAGCCAGCAGCGGAAGGCGCTCAAAGCAGTCTCCACTCTACATGGTATCGACGCGATTGCCGCGGACTTGCGGTGCGGGACGATCACGGTCGTCGGCGTCGTCGACCCCGTCGACGTCGTGGCCAAGCTGCGAAGGTTGTTTGCCAACGCTCAGATCGTCTCCGTCGGGCCGGCCAAAGAGGAGAAGAAGGACGGCGACAAGAAGGACGGCGCCGACAAGAAGAAGCCCGTACCGGTCCCGCCGGTGTACTATCCCTTTCCCTACTATCCGCCCCCTCGTCCTCGGTACGAGTTTACAGTCGGGTTCTTGAACAGCATCACAGACAATTTCTCCGAGGCGCGCATCATTGTCCGTGGTCGGCATGGAATAGTCTACAAGGGAGTGCTGGACAATGGGCAGTACATTGCTGTGAAGAAGCTTCACCTCATGCCGGGGCTGGACGATGAGGAATTCAAAAACGAGTTTAATAATCTTATGAGGGTCCGACATCAAAATATCATACCGTTGGTTGGTTACTGCCATCACACAAAACAGGTGCTTGTTGAGCACAATGGAAAGCATGTTTCTGCTCGAGTAGAAGAAAGATATTTATGCTCCGAATACTTGGAGGGAGGAAGCCTTGACAAGCATCTTTCTAATGAACCATGCGCACTTGCTTGGTACACATGTTACAAAATAATTAAAGGCATCTGTGATGGTTTACTTTGCCTTCACAAGGGATTCCAAGAGCCTATTTGGCATTTAGAATTAAAACCTACAAAAATTTTGCTGGATAAGGACATGATGCCCAAAATTGGAGGTTTTGGTTTCTCTAGACTCTTTGATTCAATAGAAACCTCCAGCACATCAGAAGTTAGGGGAACAAGTGTATATATGCCACCAGAATACATCAGTAAACGGCTAATCACATCAAGTAATGTATTCAGTCTGGGTGTCATAATCTTGCAAATTATGGCAGGAAAGGAGAGCTATACCAAATGTGTAGACATTCCACCCGAAGAGTTTACTGAGCGTGTATATGGATTCTGGGTAAATAGGATGCCGGGCACAGTATCGAAGCATACTTCCAATGAAGTTAAAACATGCATCGAAATAGCTCTAAAATGCGTGGAGTCCAATCGAGTGAACAGGCCTACTATAAATGAGATCATACAAAGGATGGATAAGATTGATATTGTTGAGTGCTCATCTTTAGGTGATCTATATAAGACAAGGGAGTTTGCATTCGAGTTCTTAGAACATATTACAAATGTTTTTTCTGAGAAGAACATAATTGGTCGTGGTGCATGTGGGGTTATTTACAAGGGAGTGTTGGACAATGGAGAAGAAATTGCTGTTAAGAAACTTCATCAAACGTTGTCTATTGATGATGGGCTATTTAAGAAAGAGGTTAATAATGTAATGAGGGCCGAACATAAAAATATTGTACGGTTAGTTGGCTACTGCCACCATATATCACCAATAATTGTTGAGCACGAAGGAAAACATGTTTCTGCTAGTGTGATAGAAAGAGTGATTTGTTTCGAATACATGCAACGAGGAAGCCTTGACGACCAACTTTCAGCTGAATCCTGCAAACTTGATTGGGACAGATGTTACAAAATAATAAAAGGAATATGTGAGGGGTTACATTACCTTCATAATGCTGTCCCTCCCATTTACCATGGGGACTTAAAACCCGGAAATATTTTGCTGGATAAGGATATGGTGGCAAAGATCGGTGATTTTGGTTTGTCAAGAGTCTTTGATACAACGCAAACCTATATGACAACATCCGGAGTTATTAAAGGAACACCTGGATACATGTCACCAGAATACATCAATGAACATAAGATCAGTCTGAAGTCTGATGTATTTGCTCTCGGGGTCATAATCATAAAAATGATGACAGGAAAGGAGGACTACTCCAACTATGCACACACCCCTCGGGAAGAATTTATTGAGCATGTATGTAAAAAATGGCAAGTGAGGCTGCATGCAACAATGCGGTCCCATGTATTTGAAGAAGTGAGGACATGCATCGGAATAGCATTAAAATGTGTGGAGGATGACCGAACTCAAAGGCCTACGATGGCTCAGATTTTGAATGAATTAAGTAACATTGGTATTGTTAAGAGATCACCAGTAGATCGGGTGCAGGAAACAATGTCTACCCAAGTATCCGAAGAAGTGAGGACATGCATCGAAATAGTGTTAAAATGTGTGGAGGATGACAGAACGCAAAGGCCTACAATAGCCCAGATTGTTAATGAACTAAGTAAGATTGGTATTGCTAAAGGTTCATCCATCAGCCAGATTTCCCAGGCTACTTCTTCCAGCCCAGAGCAGACGACACAAGGAGGAGGCCATCAGGTAAACAAGCTGACTGCAACGCCACTAGAAGAAAAGTCGAGATCATGCCCTGGCCAAGCGTGCAAAGAACTGAAGCTAAAGAGGAAAGTAAAACTGAAGTTGAAGAGGAACGTAAAATGA


Protein sequences

Name Description Sequence
stem rust resistance protein Rpg1 stem rust resistance protein Rpg1 [Hordeum vulgare subsp. vulgare].

MMRRMVMKVALEDRSQQRKALKAVSTLHGIDAIAADLRCGTITVVGVVDPVDVVAKLRRLFANAQIVSVGPAKEEKKDGDKKDGADKKKPVPVPPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVSEEVRTCIEIVLKCVEDDRTQRPTIAQIVNELSKIGIAKGSSISQISQATSSSPEQTTQGGGHQVNKLTATPLEEKSRSCPGQACKELKLKRKVKLKLKRNVK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
94-401 Kinase_like
Protein kinase-like domain

PPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRM

Gene3D: G3DSA:3.30.200.20
112-183 G3DSA:3.30.200.20

FTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPL

ProfileScan: PS50011
IPR000719
124-404 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKI

HMMPfam: PF00069
IPR017442
127-400 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

Gene3D: G3DSA:1.10.510.10
184-400 G3DSA:1.10.510.10

VGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

superfamily: SSF56112
IPR011009
405-735 Kinase_like
Protein kinase-like domain

DIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVS

Gene3D: G3DSA:3.30.200.20
417-488 G3DSA:3.30.200.20

KTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKN

HMMPanther: PTHR24420
419-715 PTHR24420,FAMILY NOT NAMED

REFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNI

ProfileScan: PS50011
IPR000719
433-717 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGI

HMMPfam: PF00069
IPR017442
435-711 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNE

Gene3D: G3DSA:1.10.510.10
489-712 G3DSA:1.10.510.10

IVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNEL

PatternScan: PS00108
IPR008271
567-579 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHGDLKPGNILL


List of References

R Brueggeman, N Rostoks, D Kudrna, A Kilian, F Han, J Chen, A Druka, B Steffenson, A Kleinhofs
The barley stem rust-resistance gene Rpg1 is a novel disease-resistance gene with homology to receptor kinases.
Proc. Natl. Acad. Sci. U.S.A.: 2002, 99(14);9328-33
PubMed:12077318 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox