PRGDB00063090 (protein kinase)

From PRG Wiki
Jump to: navigation, search
protein kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212552161 (EU848490)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max protein kinase mRNA, complete cds.

DNA Sequence

ATGGAAGCATCGCCGCCGCCGTCACCGTCGCCGTCACCACGGACCACCATCCTGGCCAAGTACCAGCTCACGCGTTTCCTCGGCCGCGGCAACTTCGCTAAGGTCTACCAGGCGCGCTCCCTCCTCGACGGCGCCACGGTAGCCGTGAAGGCCATCGACAAGTCCAAGACGGTGGACGCCGCCATGGAGCCCCGCATCGTGCGTGAGATCGACGCCATGCGCCGCCTCCACCACCACCCCAACATCCTCAAAATCCACGAGGTCCTCGCCACCAAGACCAAGATCTACCTCATCGTCGACTTCGCCGGTGGCGGCGAGCTCTTCTCCAAGCTCACCCGCCGCGGCCGCCTCCCGGAGCCCCTCGCCCGCCGCTACTTCGCGCAGCTCGTCTCCGCTCTCCGCTTCTGCCACCGCCATGGCGTCGCCCACCGAGACCTCAAGCCACAGAACCTCCTCCTCGACGCCGCCGGCAACCTCAAGGTCTCCGACTTCGGCCTCTCCGCCCTCCCGGAACACCTCCACGACGGTCTCCTCCACACCGCCTGCGGCACGCCGGCCTTCACCGCGCCAGAGATCCTCCGCCGCGTCGGCTACGACGGCTCAAAAGCCGACGCCTGGTCCTGCGGCGTCATCCTCTACAACCTCCTCGCCGGCCACCTCCCCTTCGACGACTCCAACATCCCCGCCATGTGCCGGCGCATCTCCCGCCGCGACTACCAGTTCCCGGCATGGATCTCGAAATCCGCACGGAGCCTCATTTACCAATTGCTCGACCCAAACCCTATAACACGAATTTCGTTAGAAAAAGTTTGCGATAACAATAAATGGTTCAAGAATAATTCAATGGTGGAAGTGAAAGAGAGTGTTTGGGAGTCTGATTTGTATAACAAGTGTTGCGACGGTGGTTATAAATCGGGGATGAACGCATTTGACATAATATCGATGTCGTCGGGGTTGGATTTGCGAGGGTTGTTCGAAACGACGTCGGAGAAGGGGAGAAGGAGGGAGAAGAGGTTCACTTCGGATAAAAAAGTGGAAACAGTGGAAGCGAAGGTGAAGGAAGTTGGAGAGAAATTAGGGTTTAGGATTGAGATAGGGAAGAACGGTGCTATTGGGTTGGGAAAGGGGAAGGTGGGTGTTGTGGTTGAGGTGTTTGAGATTGTGGCTGACTTGTTGCTTGTGGCGGTCAAAGTGGTGGATGGTGGGCTGGAGTTTGAGGAGCTTCATTGGGATGATTGGAGAATTGGCCTTCAAGATCTTGTTCTCTCATGGCATGATGTTGGATTGGAGCTTTAG


Protein sequences

Name Description Sequence
protein kinase protein kinase [Glycine max].

MEASPPPSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYNKCCDGGYKSGMNAFDIISMSSGLDLRGLFETTSEKGRRREKRFTSDKKVETVEAKVKEVGEKLGFRIEIGKNGAIGLGKGKVGVVVEVFEIVADLLLVAVKVVDGGLEFEELHWDDWRIGLQDLVLSWHDVGLEL

protein kinase protein kinase [Glycine max].

MEASPPPSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYNKCCDGGYKSGMNAFDIISMSSGLDLRGLFETTSEKGRRREKRFTSDKKVETVEAKVKEVGEKLGFRIEIGKNGAIGLGKGKVGVVVEVFEIVADLLLVAVKVVDGGLEFEELHWDDWRIGLQDLVLSWHDVGLEL

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
5-120 G3DSA:3.30.200.20

PPPSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEP

Gene3D: G3DSA:3.30.200.20
5-120 G3DSA:3.30.200.20

PPPSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEP

superfamily: SSF56112
IPR011009
7-272 Kinase_like
Protein kinase-like domain

PSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCD

superfamily: SSF56112
IPR011009
7-272 Kinase_like
Protein kinase-like domain

PSPSPSPRTTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCD

HMMPanther: PTHR24343:SF130
15-296 PTHR24343:SF130

TTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYN

HMMPanther: PTHR24343
15-296 PTHR24343,SERINE/THREONINE KINASE

TTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYN

HMMPanther: PTHR24343:SF130
15-296 PTHR24343:SF130

TTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYN

HMMPanther: PTHR24343
15-296 PTHR24343,SERINE/THREONINE KINASE

TTILAKYQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSMVEVKESVWESDLYN

HMMPfam: PF00069
IPR017442
21-273 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDN

ProfileScan: PS50011
IPR000719
21-277 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWF

HMMSmart: SM00220
IPR002290
21-277 S_TKc
Serine/threonine-protein kinase domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWF

HMMPfam: PF00069
IPR017442
21-273 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDN

ProfileScan: PS50011
IPR000719
21-277 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWF

HMMSmart: SM00220
IPR002290
21-277 S_TKc
Serine/threonine-protein kinase domain

YQLTRFLGRGNFAKVYQARSLLDGATVAVKAIDKSKTVDAAMEPRIVREIDAMRRLHHHPNILKIHEVLATKTKIYLIVDFAGGGELFSKLTRRGRLPEPLARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWF

PatternScan: PS00107
IPR017441
27-50 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGNFAKVYQARSLLDGATVAVK

PatternScan: PS00107
IPR017441
27-50 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGNFAKVYQARSLLDGATVAVK

Gene3D: G3DSA:1.10.510.10
121-282 G3DSA:1.10.510.10

LARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSM

Gene3D: G3DSA:1.10.510.10
121-282 G3DSA:1.10.510.10

LARRYFAQLVSALRFCHRHGVAHRDLKPQNLLLDAAGNLKVSDFGLSALPEHLHDGLLHTACGTPAFTAPEILRRVGYDGSKADAWSCGVILYNLLAGHLPFDDSNIPAMCRRISRRDYQFPAWISKSARSLIYQLLDPNPITRISLEKVCDNNKWFKNNSM

PatternScan: PS00108
IPR008271
141-153 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHRDLKPQNLLL

PatternScan: PS00108
IPR008271
141-153 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHRDLKPQNLLL

ProfileScan: PS50816
IPR018451
302-326 NAF
NAF/FISL domain

GYKSGMNAFDIISMSSGLDLRGLFE

ProfileScan: PS50816
IPR018451
302-326 NAF
NAF/FISL domain

GYKSGMNAFDIISMSSGLDLRGLFE

HMMPfam: PF03822
IPR004041
307-364 NAF
NAF domain

MNAFDIISMSSGLDLRGLFETTSEKGRRREKRFTSDKKVETVEAKVKEVGEKLGFRIE

HMMPfam: PF03822
IPR004041
307-364 NAF
NAF domain

MNAFDIISMSSGLDLRGLFETTSEKGRRREKRFTSDKKVETVEAKVKEVGEKLGFRIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox