PRGDB00063095 (protein kinase)

From PRG Wiki
Jump to: navigation, search
protein kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717150 (EU888328)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max clone 8070619 protein kinase mRNA, complete cds.

DNA Sequence

ATGCTGCACCCTTCCCTAACACTCCTCCTCCTCCTCCTCCTCTTTCACCCCAACGCCGGGGACCCTAACGACGCCAAAATCCTCCGGCAACTCCGCAACGGGCTGGACAACCCAGAACAACTGCCATGGCCGGACGAGGGCGACGACCCATGTGGTTGGAAATACATTTTCTGCGACAGCAACAAACGCGTGAACCAGATTCAACCCAAGGGCTTAAACCTCAGCGGTCCCTTGCCGCAGAACCTGAACCAGCTCACCATGCTCTTCAACTTGGGCCTCCAGAACAACAGGCTCAACGGCCCATTACCCTCCTTCCGCGGTCTGTCAAAGCTCAAATACGCCTACCTCGACAACAACAACTTCGACTCCATCCCTTCAGATTTCTTCGACGGCCTCCAGAGTCTAGAAGTTTTGGCCTTGGACCATAATAACCTCAACGCCAGCACCGGCGGCTGGCAGTTACCCGAAACTCTCCAGGAGTCAACGCAGTTGACCAATTTCTCTTGTATGGGCTGCAACCTCACCGGCCCAATACCTCAATTTCTCGGCTCCATGAACTCACTGTCGTTTTTGAAGCTCTCTAACAACTACTTAACGGGTGACATTCCCCGGAGTTTAAACGACTCTGCGTTGCAGGTTCTGTGGCTGAACAACCAGCAGGGAGAGCGTCTCAGTGGGGGAATTGATGTTGTGGCTTCTATGGTTTCTCTCACGAGTTTGTGGCTTCACGGAAACGCTTTCACTGGGACGATCCCCGAGAACATTGGGGCTTTGAGCTCTTTGAAGGAGCTCAACCTTAATGGGAACAACCTCGTTGGGTTGGTTCCTCGAGGTTTGGGTGACATGAAGCTGGGCAAGCTGGATTTGAACAATAACCATTTTATGGGTCCGATTCCGGATTTTAAAGCGGCTACTGTGTCGTATGATGTTAATAATTTTTGTGTGAGCAAACCGGGGGTTCCTTGCGCGTTTGAGGTGATGGCGTTGTTAGGGTTTCTTGGTGGGTTGAATTATCCTCTGAATTTGGTTGATTCGTGGACTGGGAATGATCCTTGTGGGGGGAATTGGTTGGGGATAAAGTGTAATGCTGATGGAAAGGTGATTATGATTAATTTGCCTAATTTGAATCTTAGTGGGAGTTTAAGTCCTTCTGTTGCGAACTTGGGTTCTCTCGTTGAGATTAGGTTGGGGGGGAATGATATTAGTGGTGTGGTGCCTGGTAATTGGACTAGTTTGGCATCTTTGAAATCGTTGGATCTGAGTGGGAACAACATTTATCCTCCACTGCCTGACTTTAAGACTGGATTGAAACCTGTTGTTGTGGGGAATCCTCTGTTAAATGGTGGAGCGAAAACTACTCCTTCGGGGAACAATAACCCGTCAACTGGATCTGGGAATGTTGACCCTTCAGGGAACACTAACTCGAATTCTAGTTCAAGTGATTCTCATGAAACTAAGAAATCCAAAAGGAAACAGTTGGTTTCGATTGTTGCTCCGATTGCGGGTGTGGCAGCTGCGGCTTTTCTGCTCATTCCGCTCTATGCATACTGTTTCAGGAGGAGGAACGGTGGCTTCCAGGCTCCAACTTCACTGGTAATTCACCCTAGGGATCCATCGGATTCGGACAGTGCTGTGAAGATTGCTGTTGCTAATAATACCAATGGAAAGCATTTCCACTTTGACAGGGAGAATAGTAGTGGAATTGGGGACTCTCACATCATTGAAGCTGGAAATCTAAGGATATCAGTTCAGGTTCTGAGGAAAGTGACCGAGAACTTTGCGCCTGAGAATGAGCTTGGCCGTGGTGGATTTGGGGTTGTTTATAAGGGGGAGTTGGATGATGGTACTAAAATTGCAGTGAAACGAATGGAAGCAGGTGTGATTAGTAGTAAGGCCTTGGATGAATTCCAGTCTGAGATTGCAGTTCTATCGAAAGTCCGACACCGGCATCTGGTGTCTCTTTTGGGTTATTCTACAGAGGGTAATGAAAGAATTCTAGTGTACGAGTATATGCCACAAGGGGCTCTCAGTAAGCATCTTTTCCATTGGAAGAGCCATGATCTGGAGCCCCTCTCTTGGAAGAGGAGACTCAATATTGCCTTGGATGTTGCCAGAGGGATGGAGTATCTCCATACTCTGGCTCACCAAAGCTTCATTCACAGAGATCTTAAGCCGTCAAATATCTTGCTTGCTGATGATTTCAAAGCAAAAGTCTCCGATTTTGGGTTGGTAAAACTTGCTCCTGAAGGGGAAAAAGCATCTGTAGTGACCCGGCTTGCAGGGACGTTTGGATATTTGGCGCCAGAATATGCAGTGACAGGAAAAATCACTACCAAAGCAGATGTTTTCAGTTTTGGGGTTGTGCTAATGGAGTTGTTGACTGGATTAATGGCACTTGATGAGGATAGACCTGAGGAAAGCCAATACTTGGCAGCATGGTTCTGGCATATAAAATCAGATAAGAAGAAACTAATGGCTGCTATCGATCCTGCCCTTGATGTAAAAGAAGAAACATTTGAGAGCGTCTCCATCATTGCTGAGCTAGCAGGGCACTGCACTGCAAGAGAACCAAGCCAACGGCCAGATATGGGTCATGCCGTGAATGTGTTGGCACCGCTTGTCGAAAAATGGAAACCCTTTGATGATGACACCGAGGAGTATTCCGGCATTGATTATAGCCTTCCCCTTAACCAGATGGTGAAGGGATGGCAAGAGGCAGAAGGAAAGGACTTAAGTTATATGGACCTTGAAGACACAATCTTATGTCAACGTTGTTTGTGTGAGACTTTAATATGTACCTTTTCCCCGTGTTGCATTGATCATGCAACACAAACCGAAAACAGATTTTCACGAGGACTCCTCTATTCAAGATCTAGTAGCAATAGGGACTACAACTTGTTGTATACTGTGAAAAAGATTACGAGGAATTTGAAAGCAGCTACTCGTGCCGACACCTGGCCCATCTGCGCTTATGACAAATTCTATTGGCCACGTGATAGGACTCATACACCAATCAATGCAATTATTAATTATTTCTGA


Protein sequences

Name Description Sequence
protein kinase protein kinase [Glycine max].

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTFSPCCIDHATQTENRFSRGLLYSRSSSNRDYNLLYTVKKITRNLKAATRADTWPICAYDKFYWPRDRTHTPINAIINYF

protein kinase protein kinase [Glycine max].

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTFSPCCIDHATQTENRFSRGLLYSRSSSNRDYNLLYTVKKITRNLKAATRADTWPICAYDKFYWPRDRTHTPINAIINYF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
1-934 PTHR24420:SF467,SUBFAMILY NOT NAMED

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTF

HMMPanther: PTHR24420
1-934 PTHR24420,FAMILY NOT NAMED

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTF

HMMPanther: PTHR24420:SF467
1-934 PTHR24420:SF467,SUBFAMILY NOT NAMED

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTF

HMMPanther: PTHR24420
1-934 PTHR24420,FAMILY NOT NAMED

MLHPSLTLLLLLLLFHPNAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAATVSYDVNNFCVSKPGVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLKPVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLVSIVAPIAGVAAAAFLLIPLYAYCFRRRNGGFQAPTSLVIHPRDPSDSDSAVKIAVANNTNGKHFHFDRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYSLPLNQMVKGWQEAEGKDLSYMDLEDTILCQRCLCETLICTF

superfamily: SSF52058
18-304 SSF52058,LRR

NAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAA

superfamily: SSF52058
18-304 SSF52058,LRR

NAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKAA

HMMPfam: PF08263
IPR013210
22-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCD

HMMPfam: PF08263
IPR013210
22-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCD

Gene3D: G3DSA:3.80.10.10
26-303 G3DSA:3.80.10.10

KILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKA

Gene3D: G3DSA:3.80.10.10
26-303 G3DSA:3.80.10.10

KILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGPLPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGDIPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHFMGPIPDFKA

HMMPfam: PF13855
90-145 LRR_8,Leucine rich repeat

NLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNL

HMMPfam: PF13855
90-145 LRR_8,Leucine rich repeat

NLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALDHNNL

HMMPfam: PF13855
236-294 LRR_8,Leucine rich repeat

SLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHF

HMMPfam: PF13855
236-294 LRR_8,Leucine rich repeat

SLTSLWLHGNAFTGTIPENIGALSSLKELNLNGNNLVGLVPRGLGDMKLGKLDLNNNHF

superfamily: SSF52058
319-437 SSF52058,LRR

GVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLK

superfamily: SSF52058
319-437 SSF52058,LRR

GVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLK

Gene3D: G3DSA:3.80.10.10
326-432 G3DSA:3.80.10.10

VMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDF

Gene3D: G3DSA:3.80.10.10
326-432 G3DSA:3.80.10.10

VMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGKVIMINLPNLNLSGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDF

HMMPfam: PF08263
IPR013210
327-362 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

MALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCN

HMMPfam: PF08263
IPR013210
327-362 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

MALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCN

HMMPfam: PF00560
IPR001611
414-433 LRR_1
Leucine-rich repeat

SLKSLDLSGNNIYPPLPDFK

HMMPfam: PF00560
IPR001611
414-433 LRR_1
Leucine-rich repeat

SLKSLDLSGNNIYPPLPDFK

Gene3D: G3DSA:2.60.120.200
IPR013320
561-611 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

DRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGE

Gene3D: G3DSA:2.60.120.200
IPR013320
561-611 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

DRENSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGE

superfamily: SSF56112
IPR011009
565-893 Kinase_like
Protein kinase-like domain

SSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYS

superfamily: SSF56112
IPR011009
565-893 Kinase_like
Protein kinase-like domain

SSGIGDSHIIEAGNLRISVQVLRKVTENFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLVEKWKPFDDDTEEYSGIDYS

ProfileScan: PS50011
IPR000719
593-874 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLV

ProfileScan: PS50011
IPR000719
593-874 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPLV

HMMPfam: PF00069
IPR017442
597-867 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAV

HMMPfam: PF00069
IPR017442
597-867 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAV

PatternScan: PS00107
IPR017441
599-621 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGVVYKGELDDGTKIAVK

PatternScan: PS00107
IPR017441
599-621 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGVVYKGELDDGTKIAVK

Gene3D: G3DSA:3.30.200.20
612-663 G3DSA:3.30.200.20

LDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNE

Gene3D: G3DSA:3.30.200.20
612-663 G3DSA:3.30.200.20

LDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYSTEGNE

Gene3D: G3DSA:1.10.510.10
664-868 G3DSA:1.10.510.10

RILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVN

Gene3D: G3DSA:1.10.510.10
664-868 G3DSA:1.10.510.10

RILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFIHRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVN

PatternScan: PS00108
IPR008271
718-730 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL

PatternScan: PS00108
IPR008271
718-730 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox