PRGDB00063100 (protein kinase)

From PRG Wiki
Jump to: navigation, search
protein kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717140 (EU888323)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max clone 8070614 protein kinase mRNA, complete cds.

DNA Sequence

ATGTTGGCACGTGACCCGGTGACCGTGCCAAAACGTCTTCAATGCATAGAATTGGTTGCCGCGGCCTCCATTGAAGACTCCAAGAAGGCCTTGTCAAGCTGGTTCAACACTTCCTCAAACCACCACTGTAACTGGACTGGAATCACTTGCTCCACCACACCTTCACTCTCAGTAACTTCTATCAACCTTCAAAGCCTAAACCTTTCTGGAGATATCTCATCTTCAATATGTGACCTTCCAAATCTGTCTTATCTCAACCTTGCTGACAACATCTTCAACCAACCCATCCCTCTTCATCTCTCTCAGTGTAGTTCTTTGGAGACTTTGAATCTCAGCACCAACCTCATATGGGGCACTATCCCTTCTCAGATTTCTCAGTTTGGTTCATTGAAAGTGCTTGATTTGAGCAGAAACCACATAGAGGGAAACATTCCTGAAAGCATAGGCTCCTTGAAGAACCTCCAAGTTCTCAACTTGGGAAGCAACTTGCTTTCAGGTAGTGTACCTGCTGTCTTTGGAAATCTAACCAAACTTGAGGTTCTTGATTTGTCTCAGAATCCATACTTGGTGAGTGAGATTCCTGAGGACATTGGTGAGCTTGGAAATCTAAAGCAACTTCTGTTGCAAAGCTCTTCTTTTCAAGGTGGAATTCCAGAATCTCTGGTGGGCCTTGTCAGCTTGACCCATTTGGATCTCTCTGAGAACAACCTAACAGGTGGGGTTACAAAGGCTCTACAACCATCTTCTCTCAAGAACCTGGTTTCATTGGATGTTTCACAAAACAAGCTTTTGGGGCCATTTCCAAGTGGCATATGCAGGGGACAAGGCCTTATTATTAACCTCAGTCTCCACACAAATGCCTTCACTGGTTCAATACCTAATTCCATTGGTGAATGTAAGAGCCTTGAGAGGTTCCAAGTCCAGAACAATGGTTTCTCTGGTGATTTCCCCATTGGATTGTGGTCATTACCCAAAATTAAGCTCATCAGAGCTGAAAACAACAGATTCTCAGGGAAGATACCCGAGTCAGTTTCAGGAGCTGGTCAGTTGGAGCAAGTTCAACTTGACAACAACACCTTTGCTGGTAAAATTCCTCAAGGTCTTGGCCTTGTCAAGAGCTTATACAGATTTTCTGCTTCTCTCAACCGTTTCTATGGTGAACTTCCTCCGAACTTTTGTGACTCTCCTGTTATGAGCATAGTGAATCTCTCCCACAATTCTCTTTCTGGACAAATTCCAGAGCTGAAAAAATGCAGGAAACTTGTTTCATTGTCTTTAGCTGATAACAGTCTAATAGGAGAAATACCATCTTCCCTTGCTGAGCTACCTGTGCTTACTTACCTTGATCTTTCAGATAACAATCTCACTGGTTCAATCCCACAAGGGCTTCAAAACTTGAAGCTTGCTCTTTTCAATGTGTCCTTCAATCAGCTATCAGGTAAGGTACCATACTCCTTGATTTCTGGTCTCCCTGCCTCATTTTTGGAAGGAAACCCTGATCTTTGTGGCCCTGGATTGCCTAACTCTTGCTCTGATGACATGCCAAAACACCACATTGGTAGCACAACAACCTTAGCTTGTGCCCTCATCTCTTTAGCCTTTGTTGCTGGAACTGCCATTGTTGTTGGTGGCTTTATTTTGTATAGGAGATCTTGCAAGGGTGATCGAGTTGGCGTTTGGCGCTCGGTGTTCTTCTATCCTCTCAGGATTACTGAGCATGATCTGCTTATGGGGATGAATGAGAAGAGCTCAAGGGGAAATGGTGGGGCTTTTGGTAAAGTTTATGTTGTGAATTTGCCTAGTGGTGAACTAGTAGCTGTGAAGAAGTTGGTTAATTTTGGAAACCAGTCCTCAAAAAGTTTGAAGGCTGAGGTCAAGACTTTGGCAAAAATTAGGCACAAGAATGTTGTTAAAATTCTGGGGTTCTGCCACTCTGATGAGTCAGTATTTCTCATTTATGAGTACTTGCATGGAGGGAGCTTAGGGGATTTGATTTCTCGTCCGAATTTTCAGTTGCAGTGGGGACTTCGATTGAGAATTGCCATTGGAGTTGCTCAAGGACTGGCTTATCTTCACAAGGATTATGTCCCTCACTTGCTTCACAGAAATGTCAAGTCAAGTAACATTTTGTTGGAGGCAAACTTTGAGCCAAAACTCACAGATTTCGCTCTTGATCGAGTAGTGGGAGAAGCTGCATTTCAATCAGTTTTGAACTCTGAAGCAGCATCTTCATGTTACATTGCACCAGAAAATGGTTACAGTAAGAAAGCAACTGAACAATTGGACATCTACAGCTTTGGTGTGGTATTGCTAGAGCTAGTGAGTGGCAGGAAAGCAGAGCAAACAGAGTCTAGTGACTCACTTGACATTGTGAAGTGGGTTAGAAGGAAAGTGAATATCACTAATGGGGTGCAACAAGTTCTTGACCCTAAAATCTCACACACTTGTCACCAAGAAATGATTGGAGCCTTAGACATTGCGCTTCGTTGCACTTCTGTGGTGCCTGAGAAAAGGCCATCCATGGTAGAAGTTATTTTAATTAAAGGATTTCGTCGGATAGAGCATAAATTTTACACTAATATTTAA


Protein sequences

Name Description Sequence
protein kinase protein kinase [Glycine max].

MLARDPVTVPKRLQCIELVAAASIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHKFYTNI

protein kinase protein kinase [Glycine max].

MLARDPVTVPKRLQCIELVAAASIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHKFYTNI

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
8-273 SSF52058,LRR

TVPKRLQCIELVAAASIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICR

superfamily: SSF52058
8-273 SSF52058,LRR

TVPKRLQCIELVAAASIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICR

HMMPfam: PF08263
IPR013210
22-51 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ASIEDSKKALSSWFNTSSNHHCNWTGITCS

HMMPfam: PF08263
IPR013210
22-51 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ASIEDSKKALSSWFNTSSNHHCNWTGITCS

Gene3D: G3DSA:3.80.10.10
23-277 G3DSA:3.80.10.10

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGL

HMMPanther: PTHR24420:SF84
23-845 PTHR24420:SF84,OS04G0472500 PROTEIN

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVI

HMMPanther: PTHR24420
23-845 PTHR24420,FAMILY NOT NAMED

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVI

Gene3D: G3DSA:3.80.10.10
23-277 G3DSA:3.80.10.10

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGL

HMMPanther: PTHR24420:SF84
23-845 PTHR24420:SF84,OS04G0472500 PROTEIN

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVI

HMMPanther: PTHR24420
23-845 PTHR24420,FAMILY NOT NAMED

SIEDSKKALSSWFNTSSNHHCNWTGITCSTTPSLSVTSINLQSLNLSGDISSSICDLPNLSYLNLADNIFNQPIPLHLSQCSSLETLNLSTNLIWGTIPSQISQFGSLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQNPYLVSEIPEDIGELGNLKQLLLQSSSFQGGIPESLVGLVSLTHLDLSENNLTGGVTKALQPSSLKNLVSLDVSQNKLLGPFPSGICRGQGLIINLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSCSDDMPKHHIGSTTTLACALISLAFVAGTAIVVGGFILYRRSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVI

ProfileScan: PS51450
IPR001611
62-83 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLNLSGDISSSICDLPNLS

ProfileScan: PS51450
IPR001611
62-83 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLNLSGDISSSICDLPNLS

HMMPfam: PF13516
103-125 LRR_6,Leucine Rich repeat

CSSLETLNLSTNLIWGTIPSQIS

HMMPfam: PF13516
103-125 LRR_6,Leucine Rich repeat

CSSLETLNLSTNLIWGTIPSQIS

ProfileScan: PS51450
IPR001611
105-127 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLETLNLSTNLIWGTIPSQISQF

ProfileScan: PS51450
IPR001611
105-127 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLETLNLSTNLIWGTIPSQISQF

ProfileScan: PS51450
IPR001611
129-151 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVLDLSRNHIEGNIPESIGSL

ProfileScan: PS51450
IPR001611
129-151 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVLDLSRNHIEGNIPESIGSL

HMMPfam: PF13855
129-186 LRR_8,Leucine rich repeat

SLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQN

HMMPfam: PF13855
129-186 LRR_8,Leucine rich repeat

SLKVLDLSRNHIEGNIPESIGSLKNLQVLNLGSNLLSGSVPAVFGNLTKLEVLDLSQN

ProfileScan: PS51450
IPR001611
153-175 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLNLGSNLLSGSVPAVFGNL

ProfileScan: PS51450
IPR001611
153-175 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLNLGSNLLSGSVPAVFGNL

ProfileScan: PS51450
IPR001611
177-200 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLDLSQNPYLVSEIPEDIGEL

ProfileScan: PS51450
IPR001611
177-200 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLDLSQNPYLVSEIPEDIGEL

HMMPfam: PF00560
IPR001611
226-253 LRR_1
Leucine-rich repeat

SLTHLDLSENNLTGGVTKALQPSSLKNL

ProfileScan: PS51450
IPR001611
226-247 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTHLDLSENNLTGGVTKALQP

HMMPfam: PF00560
IPR001611
226-253 LRR_1
Leucine-rich repeat

SLTHLDLSENNLTGGVTKALQPSSLKNL

ProfileScan: PS51450
IPR001611
226-247 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTHLDLSENNLTGGVTKALQP

FPrintScan: PR00019
227-240 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSENNLTGG

FPrintScan: PR00019
227-240 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSENNLTGG

FPrintScan: PR00019
250-263 LEURICHRPT,Leucine-rich repeat signature

LKNLVSLDVSQNKL

FPrintScan: PR00019
250-263 LEURICHRPT,Leucine-rich repeat signature

LKNLVSLDVSQNKL

ProfileScan: PS51450
IPR001611
252-273 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVSLDVSQNKLLGPFPSGICR

ProfileScan: PS51450
IPR001611
252-273 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVSLDVSQNKLLGPFPSGICR

Gene3D: G3DSA:3.80.10.10
280-502 G3DSA:3.80.10.10

NLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLC

Gene3D: G3DSA:3.80.10.10
280-502 G3DSA:3.80.10.10

NLSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLC

superfamily: SSF52058
281-510 SSF52058,LRR

LSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSC

superfamily: SSF52058
281-510 SSF52058,LRR

LSLHTNAFTGSIPNSIGECKSLERFQVQNNGFSGDFPIGLWSLPKIKLIRAENNRFSGKIPESVSGAGQLEQVQLDNNTFAGKIPQGLGLVKSLYRFSASLNRFYGELPPNFCDSPVMSIVNLSHNSLSGQIPELKKCRKLVSLSLADNSLIGEIPSSLAELPVLTYLDLSDNNLTGSIPQGLQNLKLALFNVSFNQLSGKVPYSLISGLPASFLEGNPDLCGPGLPNSC

ProfileScan: PS51450
IPR001611
397-419 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VMSIVNLSHNSLSGQIPELKKCR

ProfileScan: PS51450
IPR001611
397-419 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VMSIVNLSHNSLSGQIPELKKCR

ProfileScan: PS51450
IPR001611
420-443 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLVSLSLADNSLIGEIPSSLAELP

ProfileScan: PS51450
IPR001611
420-443 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLVSLSLADNSLIGEIPSSLAELP

ProfileScan: PS51450
IPR001611
444-467 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLTYLDLSDNNLTGSIPQGLQNLK

ProfileScan: PS51450
IPR001611
444-467 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLTYLDLSDNNLTGSIPQGLQNLK

HMMPfam: PF00560
IPR001611
445-466 LRR_1
Leucine-rich repeat

LTYLDLSDNNLTGSIPQGLQNL

HMMPfam: PF00560
IPR001611
445-466 LRR_1
Leucine-rich repeat

LTYLDLSDNNLTGSIPQGLQNL

superfamily: SSF56112
IPR011009
550-856 Kinase_like
Protein kinase-like domain

RSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHK

superfamily: SSF56112
IPR011009
550-856 Kinase_like
Protein kinase-like domain

RSCKGDRVGVWRSVFFYPLRITEHDLLMGMNEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHK

ProfileScan: PS50011
IPR000719
580-858 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHKFY

ProfileScan: PS50011
IPR000719
580-858 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NEKSSRGNGGAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVILIKGFRRIEHKFY

Gene3D: G3DSA:3.30.200.20
589-641 G3DSA:3.30.200.20

GAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILG

HMMPfam: PF00069
IPR017442
589-844 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEV

Gene3D: G3DSA:3.30.200.20
589-641 G3DSA:3.30.200.20

GAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILG

HMMPfam: PF00069
IPR017442
589-844 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GAFGKVYVVNLPSGELVAVKKLVNFGNQSSKSLKAEVKTLAKIRHKNVVKILGFCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEV

Gene3D: G3DSA:1.10.510.10
642-846 G3DSA:1.10.510.10

FCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVIL

Gene3D: G3DSA:1.10.510.10
642-846 G3DSA:1.10.510.10

FCHSDESVFLIYEYLHGGSLGDLISRPNFQLQWGLRLRIAIGVAQGLAYLHKDYVPHLLHRNVKSSNILLEANFEPKLTDFALDRVVGEAAFQSVLNSEAASSCYIAPENGYSKKATEQLDIYSFGVVLLELVSGRKAEQTESSDSLDIVKWVRRKVNITNGVQQVLDPKISHTCHQEMIGALDIALRCTSVVPEKRPSMVEVIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox