PRGDB00063103 (ATP binding/protein serine/threonine kinase)

From PRG Wiki
Jump to: navigation, search
ATP binding/protein serine/threonine kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717134 (EU888320)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max clone 8070611 ATP binding/protein serine/threonine kinase mRNA, complete cds.

DNA Sequence

ATGAATGAGAAAGGCGCAAAAGAGGGCATCATCACCTCCCATACCATTAACACTGAGCTAATTGATGTTGCTTCATTGACCTGTGTTCTGTTCTGGCTTTGTACAAGGCTTGTTTTCTCAATGGAGAACAACCATGTTCAGTTTTTGCCTCTTCTCACCGTGACACTTCTTCTTGTGATCACTGTTTTGTTTCCTGTGACTGAGGGTGCAGCAGTTTCCTCCATCAAGACTGATGCACAGGCTCTTCTCATGTTCAAAAGGATGATTCAGAAGGATCCAAGTGGAGTTTTGTCAGGGTGGAAGCTGAATAGGAATCCATGCAGCTGGTATGGAGTCTCTTGCACCCTTGGAAGAGTTACTCAGCTTGATATTAGTGGGAGTAATGACCTTGCTGGGACTATATCTCTTGACCCTTTGTCTTCTTTAGATATGTTATCTGTTCTGAAAATGTCATTGAATTCATTTTCTGTAAATTCTACCTCTTTGCTTAATCTCCCATATAGTTTGACACAGCTTGATCTATCCTTCGGTGGAGTCACAGGTCCTGTCCCTGAGAACCTGTTCTCCAAGTGTCCAAATCTTGTTGTTGTGAATCTTTCTTACAACAACTTGACAGGCCCTATTCCTGAAAATTTCTTTCAAAATTCTGATAAACTGCAGGTCCTTGACCTCTCTTACAACAACCTGTCAGGGCCAATTTTTGGCCTGAAAATGGAGTGCATTTCCTTGTTGCAACTTGATCTATCTGGAAACCGTTTATCAGACTCAATTCCACTCTCTTTGTCAAACTGCACCAGCCTTAAAATTTTGAATTTAGCCAACAATATGGTTTCTGGGGATATCCCCAAAGCTTTTGGTCAGCTAAACAAACTACAGACTTTGGATCTTTCACACAACCAACTCAATGGCTGGATCCCTTCTGAATTTGGAAATGCATGTGCTTCCCTTTTGGAGCTCAAACTTTCTTTCAACAACATCTCAGGCTCAATCCCACCTAGTTTCTCTTCTTGCAGTTGGCTGCAACTTCTTGACATATCTAACAACAATATGTCAGGGCAGTTACCAGATGCAATCTTTCAGAACCTTGGATCATTACAGGAACTGAGGCTGGGAAATAATGCTATCACAGGTCAATTTCCATCTTCACTATCTTCCTGCAAAAAGTTGAAGATTGTGGATTTCAGCTCAAATAAAATTTATGGATCTATCCCCAGAGATTTATGTCCAGGAGCAGTCTCACTTGAGGAGCTGAGAATGCCAGACAATCTCATTACAGGAGAAATCCCAGCTGAACTGTCAAAGTGCTCAAAGCTGAAGACACTTGATTTTAGTCTGAACTATCTCAATGGTACAATTCCTGATGAGCTTGGAGAACTCGAAAATCTTGAGCAGCTAATAGCATGGTTCAATAGCTTGGAAGGAAGCATTCCACCAAAGTTGGGCCAGTGCAAGAATCTCAAGGATCTCATACTGAATAATAATCACCTCACAGGTGGAATTCCAATTGAGTTGTTCAATTGCAGCAATCTTGAATGGATATCACTGACAAGCAATGAACTCAGTTGGGAAATACCGCGCAAGTTTGGCCTCTTGACAAGGTTAGCAGTCCTGCAGCTTGGAAACAACAGCTTGACTGGGGAGATACCATCAGAGCTAGCAAATTGCAGAAGTTTGGTGTGGTTGGACTTGAACAGCAACAAGCTCACTGGAGAGATCCCTCCAAGACTTGGCAGGCAGCTAGGAGCAAAATCCTTGTTTGGGATCCTTTCAGGAAACACTTTGGTGTTTGTAAGAAATGTTGGAAACTCATGTAAAGGAGTTGGAGGTTTGCTAGAATTCTCTGGTATCCGACCTGAAAGACTCTTGCAGGTCCCAACATTGAGGACTTGTGACTTCGCAAGACTCTATTCTGGTCCTGTCCTCAGCCAGTTCACCAAGTACCAGACTCTGGAGTATCTTGATCTTTCCTATAACGAGCTTCGCGGAAAAATCCCAGATGAATTTGGAGATATGGTGGCTTTACAGGTTCTTGAATTATCTCACAATCAGCTATCTGGAGAAATCCCTTCATCACTTGGCCAGCTCAAAAATTTGGGTGTGTTTGATGCATCACACAATAGACTGCAGGGTCATATCCCAGACTCATTCTCAAACCTCTCATTCTTAGTGCAAATTGATCTATCTAACAATGAGTTAACAGGGCAGATTCCATCTAGGGGACAACTGAGTACACTTCCAGCTTCCCAGTATGCGAACAATCCAGGACTTTGTGGTGTACCATTGCCTGATTGCAAGAATGACAACAGCCAAACCACAACAAATCCAAGTGATGATGTTAGCAAAGGAGACCGTAAATCAGCAACTGCAACATGGGCAAACAGCATTGTCATGGGAATTCTCATCTCTGTTGCTTCAGTGTGTATCTTAATTGTGTGGGCAATTGCAATGCGCGCAAGGAGGAAGGAAGCCGAGGAAGTCAAGATGCTCAATAGCTTACAAGCATGCCATGCTGCTACAACATGGAAAATTGACAAAGAGAAAGAGCCCCTTAGCATTAATGTGGCAACATTTCAGAGGCAGCTGAGGAAGCTCAAGTTCTCACAGTTGATTGAAGCAACTAATGGATTCTCAGCAGCGAGCCTCATTGGGTGTGGTGGTTTTGGTGAAGTGTTCAAGGCCACACTCAAAGACGGTTCAAGTGTCGCCATAAAGAAGCTCATTCGACTGAGCTGCCAGGGCGATCGAGAATTCATGGCAGAGATGGAAACCTTAGGGAAGATCAAGCACAGAAATCTTGTCCCTTTGTTGGGGTACTGCAAAGTAGGGGAAGAGAGGCTCCTTGTGTATGAGTACATGGAGTATGGAAGCCTAGAAGAGATGCTTCATGGGAGAATCAAGACGCGTGATCGACGAATTTTGACATGGGAAGAAAGGAAGAAGATTGCAAGAGGTGCTGCTAAAGGACTTTGTTTCCTGCACCACAATTGCATCCCTCACATCATACACAGAGACATGAAATCAAGCAACGTGCTACTTGACAATGAAATGGAGTCCAGGGTCTCAGATTTTGGCATGGCAAGATTAATAAGTGCCCTTGACACACATCTTAGTGTGAGCACGCTAGCAGGAACACCTGGATATGTTCCTCCAGAGTACTACCAAAGTTTCAGGTGCACTGTCAAGGGAGATGTCTATTCATTTGGAGTTGTGATGTTGGAACTGCTGAGCGGGAAACGCCCGACTGATAAGGAGGACTTTGGTGACACCAACTTGGTGGGGTGGGCGAAGATAAAGGTCCGCGAAGGGAAGCAAATGGAAGTAATTGACAATGACTTGCTTTTGGCCACTCAAGGAACTGATGAAGCAGAAGCCAAAGAAGTGAAGGAGATGATAAGATATTTAGAGATTACTTTGCAGTGTGTTGATGACTTGCCTTCAAGAAGGCCAAACATGTTGCAGGTAGTGGCTATGCTGAGAGAGCTTATGCCTGGATCAACTGATGGAAGCAGCAACAGTGCTTGA


Protein sequences

Name Description Sequence
ATP binding/protein serine/threonine kinase ATP binding/protein serine/threonine kinase [Glycine max].

MNEKGAKEGIITSHTINTELIDVASLTCVLFWLCTRLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELMPGSTDGSSNSA

ATP binding/protein serine/threonine kinase ATP binding/protein serine/threonine kinase [Glycine max].

MNEKGAKEGIITSHTINTELIDVASLTCVLFWLCTRLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELMPGSTDGSSNSA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF924
36-1161 PTHR24420:SF924

RLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLREL

HMMPanther: PTHR24420
36-1161 PTHR24420,FAMILY NOT NAMED

RLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLREL

HMMPanther: PTHR24420:SF924
36-1161 PTHR24420:SF924

RLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLREL

HMMPanther: PTHR24420
36-1161 PTHR24420,FAMILY NOT NAMED

RLVFSMENNHVQFLPLLTVTLLLVITVLFPVTEGAAVSSIKTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLPDCKNDNSQTTTNPSDDVSKGDRKSATATWANSIVMGILISVASVCILIVWAIAMRARRKEAEEVKMLNSLQACHAATTWKIDKEKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLREL

HMMPfam: PF08263
IPR013210
76-114 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSC

HMMPfam: PF08263
IPR013210
76-114 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KTDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSC

Gene3D: G3DSA:3.80.10.10
77-297 G3DSA:3.80.10.10

TDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLS

Gene3D: G3DSA:3.80.10.10
77-297 G3DSA:3.80.10.10

TDAQALLMFKRMIQKDPSGVLSGWKLNRNPCSWYGVSCTLGRVTQLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLS

superfamily: SSF52047
121-425 SSF52047,LRR

QLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLIT

superfamily: SSF52047
121-425 SSF52047,LRR

QLDISGSNDLAGTISLDPLSSLDMLSVLKMSLNSFSVNSTSLLNLPYSLTQLDLSFGGVTGPVPENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNLSGPIFGLKMECISLLQLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLIT

HMMPfam: PF13855
184-229 LRR_8,Leucine rich repeat

PENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNL

HMMPfam: PF13855
184-229 LRR_8,Leucine rich repeat

PENLFSKCPNLVVVNLSYNNLTGPIPENFFQNSDKLQVLDLSYNNL

ProfileScan: PS51450
IPR001611
193-215 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVVNLSYNNLTGPIPENFFQN

ProfileScan: PS51450
IPR001611
193-215 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVVNLSYNNLTGPIPENFFQN

ProfileScan: PS51450
IPR001611
218-240 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLSYNNLSGPIFGLKMEC

ProfileScan: PS51450
IPR001611
218-240 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLSYNNLSGPIFGLKMEC

FPrintScan: PR00019
219-232 LEURICHRPT,Leucine-rich repeat signature

LQVLDLSYNNLSGP

FPrintScan: PR00019
219-232 LEURICHRPT,Leucine-rich repeat signature

LQVLDLSYNNLSGP

ProfileScan: PS51450
IPR001611
242-263 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLQLDLSGNRLSDSIPLSLSN

ProfileScan: PS51450
IPR001611
242-263 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLQLDLSGNRLSDSIPLSLSN

HMMPfam: PF13855
245-301 LRR_8,Leucine rich repeat

QLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQL

HMMPfam: PF13855
245-301 LRR_8,Leucine rich repeat

QLDLSGNRLSDSIPLSLSNCTSLKILNLANNMVSGDIPKAFGQLNKLQTLDLSHNQL

ProfileScan: PS51450
IPR001611
266-288 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILNLANNMVSGDIPKAFGQL

ProfileScan: PS51450
IPR001611
266-288 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILNLANNMVSGDIPKAFGQL

FPrintScan: PR00019
288-301 LEURICHRPT,Leucine-rich repeat signature

LNKLQTLDLSHNQL

FPrintScan: PR00019
288-301 LEURICHRPT,Leucine-rich repeat signature

LNKLQTLDLSHNQL

ProfileScan: PS51450
IPR001611
290-311 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQTLDLSHNQLNGWIPSEFGN

ProfileScan: PS51450
IPR001611
290-311 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQTLDLSHNQLNGWIPSEFGN

Gene3D: G3DSA:3.80.10.10
298-464 G3DSA:3.80.10.10

HNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQ

Gene3D: G3DSA:3.80.10.10
298-464 G3DSA:3.80.10.10

HNQLNGWIPSEFGNACASLLELKLSFNNISGSIPPSFSSCSWLQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKIYGSIPRDLCPGAVSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQ

ProfileScan: PS51450
IPR001611
315-337 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLELKLSFNNISGSIPPSFSSC

HMMPfam: PF00560
IPR001611
315-337 LRR_1
Leucine-rich repeat

SLLELKLSFNNISGSIPPSFSSC

ProfileScan: PS51450
IPR001611
315-337 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLELKLSFNNISGSIPPSFSSC

HMMPfam: PF00560
IPR001611
315-337 LRR_1
Leucine-rich repeat

SLLELKLSFNNISGSIPPSFSSC

ProfileScan: PS51450
IPR001611
339-361 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

WLQLLDISNNNMSGQLPDAIFQN

ProfileScan: PS51450
IPR001611
339-361 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

WLQLLDISNNNMSGQLPDAIFQN

HMMPfam: PF13855
340-399 LRR_8,Leucine rich repeat

LQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKI

HMMPfam: PF13855
340-399 LRR_8,Leucine rich repeat

LQLLDISNNNMSGQLPDAIFQNLGSLQELRLGNNAITGQFPSSLSSCKKLKIVDFSSNKI

ProfileScan: PS51450
IPR001611
364-386 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQELRLGNNAITGQFPSSLSSC

ProfileScan: PS51450
IPR001611
364-386 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQELRLGNNAITGQFPSSLSSC

ProfileScan: PS51450
IPR001611
388-410 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKIVDFSSNKIYGSIPRDLCPG

ProfileScan: PS51450
IPR001611
388-410 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKIVDFSSNKIYGSIPRDLCPG

superfamily: SSF52058
412-754 SSF52058,LRR

VSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNP

superfamily: SSF52058
412-754 SSF52058,LRR

VSLEELRMPDNLITGEIPAELSKCSKLKTLDFSLNYLNGTIPDELGELENLEQLIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQLGAKSLFGILSGNTLVFVRNVGNSCKGVGGLLEFSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNP

ProfileScan: PS51450
IPR001611
413-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELRMPDNLITGEIPAELSKCS

ProfileScan: PS51450
IPR001611
413-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELRMPDNLITGEIPAELSKCS

ProfileScan: PS51450
IPR001611
437-459 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKTLDFSLNYLNGTIPDELGEL

ProfileScan: PS51450
IPR001611
437-459 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKTLDFSLNYLNGTIPDELGEL

Gene3D: G3DSA:3.80.10.10
465-579 G3DSA:3.80.10.10

LIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQ

Gene3D: G3DSA:3.80.10.10
465-579 G3DSA:3.80.10.10

LIAWFNSLEGSIPPKLGQCKNLKDLILNNNHLTGGIPIELFNCSNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKLTGEIPPRLGRQ

ProfileScan: PS51450
IPR001611
485-506 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKDLILNNNHLTGGIPIELFN

ProfileScan: PS51450
IPR001611
485-506 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKDLILNNNHLTGGIPIELFN

HMMPfam: PF13504
485-498 LRR_7,Leucine rich repeat

NLKDLILNNNHLTG

HMMPfam: PF13504
485-498 LRR_7,Leucine rich repeat

NLKDLILNNNHLTG

HMMPfam: PF13855
508-568 LRR_8,Leucine rich repeat

SNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKL

HMMPfam: PF13855
508-568 LRR_8,Leucine rich repeat

SNLEWISLTSNELSWEIPRKFGLLTRLAVLQLGNNSLTGEIPSELANCRSLVWLDLNSNKL

ProfileScan: PS51450
IPR001611
509-531 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEWISLTSNELSWEIPRKFGLL

ProfileScan: PS51450
IPR001611
509-531 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEWISLTSNELSWEIPRKFGLL

ProfileScan: PS51450
IPR001611
533-555 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLAVLQLGNNSLTGEIPSELANC

ProfileScan: PS51450
IPR001611
533-555 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLAVLQLGNNSLTGEIPSELANC

ProfileScan: PS51450
IPR001611
557-579 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVWLDLNSNKLTGEIPPRLGRQ

ProfileScan: PS51450
IPR001611
557-579 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVWLDLNSNKLTGEIPPRLGRQ

Gene3D: G3DSA:3.80.10.10
613-762 G3DSA:3.80.10.10

FSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLP

Gene3D: G3DSA:3.80.10.10
613-762 G3DSA:3.80.10.10

FSGIRPERLLQVPTLRTCDFARLYSGPVLSQFTKYQTLEYLDLSYNELRGKIPDEFGDMVALQVLELSHNQLSGEIPSSLGQLKNLGVFDASHNRLQGHIPDSFSNLSFLVQIDLSNNELTGQIPSRGQLSTLPASQYANNPGLCGVPLP

ProfileScan: PS51450
IPR001611
649-671 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEYLDLSYNELRGKIPDEFGDM

ProfileScan: PS51450
IPR001611
649-671 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEYLDLSYNELRGKIPDEFGDM

HMMPfam: PF00560
IPR001611
650-670 LRR_1
Leucine-rich repeat

LEYLDLSYNELRGKIPDEFGD

HMMPfam: PF00560
IPR001611
650-670 LRR_1
Leucine-rich repeat

LEYLDLSYNELRGKIPDEFGD

ProfileScan: PS51450
IPR001611
673-695 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQVLELSHNQLSGEIPSSLGQL

ProfileScan: PS51450
IPR001611
673-695 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQVLELSHNQLSGEIPSSLGQL

HMMPfam: PF00560
IPR001611
674-695 LRR_1
Leucine-rich repeat

LQVLELSHNQLSGEIPSSLGQL

HMMPfam: PF00560
IPR001611
674-695 LRR_1
Leucine-rich repeat

LQVLELSHNQLSGEIPSSLGQL

ProfileScan: PS51450
IPR001611
697-719 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLGVFDASHNRLQGHIPDSFSNL

ProfileScan: PS51450
IPR001611
697-719 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLGVFDASHNRLQGHIPDSFSNL

HMMPfam: PF00560
IPR001611
698-719 LRR_1
Leucine-rich repeat

LGVFDASHNRLQGHIPDSFSNL

HMMPfam: PF00560
IPR001611
698-719 LRR_1
Leucine-rich repeat

LGVFDASHNRLQGHIPDSFSNL

ProfileScan: PS51450
IPR001611
721-743 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLVQIDLSNNELTGQIPSRGQLS

ProfileScan: PS51450
IPR001611
721-743 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLVQIDLSNNELTGQIPSRGQLS

superfamily: SSF56112
IPR011009
846-1158 Kinase_like
Protein kinase-like domain

EKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAML

superfamily: SSF56112
IPR011009
846-1158 Kinase_like
Protein kinase-like domain

EKEPLSINVATFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAML

Gene3D: G3DSA:3.30.200.20
856-938 G3DSA:3.30.200.20

TFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGY

Gene3D: G3DSA:3.30.200.20
856-938 G3DSA:3.30.200.20

TFQRQLRKLKFSQLIEATNGFSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGY

ProfileScan: PS50011
IPR000719
876-1162 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELM

ProfileScan: PS50011
IPR000719
876-1162 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSAASLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELM

HMMPfam: PF07714
IPR001245
880-1158 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAML

HMMPfam: PF07714
IPR001245
880-1158 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGCGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGDTNLVGWAKIKVREGKQMEVIDNDLLLATQGTDEAEAKEVKEMIRYLEITLQCVDDLPSRRPNMLQVVAML

PatternScan: PS00107
IPR017441
882-905 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGGFGEVFKATLKDGSSVAIKK

PatternScan: PS00107
IPR017441
882-905 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGGFGEVFKATLKDGSSVAIKK

Gene3D: G3DSA:1.10.510.10
939-1088 G3DSA:1.10.510.10

CKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGD

Gene3D: G3DSA:1.10.510.10
939-1088 G3DSA:1.10.510.10

CKVGEERLLVYEYMEYGSLEEMLHGRIKTRDRRILTWEERKKIARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDNEMESRVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVMLELLSGKRPTDKEDFGD

PatternScan: PS00108
IPR008271
1000-1012 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKSSNVLL

PatternScan: PS00108
IPR008271
1000-1012 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox