PRGDB00063109 (somatic embryogenesis receptor-like kinase-like protein)

From PRG Wiki
Jump to: navigation, search
somatic embryogenesis receptor-like kinase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717120 (EU888313)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max clone 8070604 somatic embryogenesis receptor-like kinase-like protein mRNA, complete cds.

DNA Sequence

ATGGATAGAGTGACTTCGTCTTTTATGGGTTCCTTTTTTGTTTGGGCAATTTTGGTGCTTGATTTGGTACTTAAGGCTTCTGGCAATCAGGAAGGCGATGCCCTGAATGCATTAAAGAGCAACTTGCAAGATCCTAACAATGTTCTTCAAAGCTGGGATGCTACCCTTGTCAATCCCTGCACGTGGTTTCATGTTACATGCAACAGTGATAACAGTGTGACCCGTGTTGATCTTGGAAATGCAGATCTTTCTGGTCAACTGGTTCCAGAACTTGGTCAACTTACAAATTTACAGTACTTTTATCAAAACAATCCTGACTTGATACAACCAAAAAACACTCCATCTCCTGTTTCTCCAACACCACCAGCAGCTTCTTCAGGTAACAGTAATACTGGAGCTATTGCTGGAGGAGTTGCTGCTGGTGCTGCTCTGTTGTTTGCAGCCCCTGCAATTGCACTTGCTTATTGGCGAAGAAGGAAACCTCAGGATCATTTCTTTGATGTTCCTGCTGAGGAGGATCCTGAAGTTCACCTTGGTCAGCTTAAAAGGTTTTCTTTGCGTGAGCTGCAAGTTGCAACAGATAACTTTAGTAACAAACACATTCTGGGTAGAGGTGGATTTGGAAAGGTTTATAAAGGACGCTTAGCTGATGGATCTCTTGTAGCAGTAAAAAGACTTAAAGAGGAACGCACGCAGGGTGGGGAGCTGCAGTTTCAAACCGAAGTGGAAATGATCAGCATGGCTGTACATCGTAATTTGCTTCGGCTTCGTGGTTTTTGTATGACACCTACTGAACGGTTGCTTGTGTATCCTTACATGGCTAACGGAAGTGTAGCATCATGTTTACGAGAACGTCAAGAATCCCAACCGCCACTTGGCTGGCCAGAACGGAAGCGTATTGCATTGGGATCTGCAAGGGGGCTTGCTTATTTGCATGATCATTGTGACCCTAAGATTATTCACCGTGATGTCAAAGCAGCTAATATATTGTTGGACGAGGAATTTGAAGCAGTTGTTGGAGATTTTGGTTTAGCTAAACTTATGGATTATAAAGATACTCATGTTACTACTGCTGTACGTGGAACAATTGGACATATAGCACCAGAATACCTCTCAACTGGAAAGTCTTCAGAGAAGACTGATGTTTTTGGATATGGTGTGATGCTTCTTGAACTAATAACTGGACAAAGGGCTTTTGATCTAGCTCGACTTGCCAATGATGATGATGTCATGTTGCTTGATTGGGTTAAAGGACTTCTCAAAGACAGGAAATTGGAAACACTAGTAGATGCAGATTTACATGGTAACTACAATGATGAGGAGGTAGAGCAGTTAATCCAAGTGGCCTTACTATGCACACAAGGATCTCCTGTGGAAAGACCTAAGATGTCTGAGGTGGTAAGAATGCTAGAAGGTGATGGTTTGGCTGAGAAATGGGAGCAATGGCAGAAAGACGAGACGTTCCGGCAAGACTTTAACAGCAACATACATCACCCTAATGCAAATTGGATAGTAGATTCAACTTCCCATATTCAGGCAGATGAACTATCAGGTCCTAGATGA


Protein sequences

Name Description Sequence
somatic embryogenesis receptor-like kinase-like protein somatic embryogenesis receptor-like kinase-like protein [Glycine max].

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADELSGPR

somatic embryogenesis receptor-like kinase-like protein somatic embryogenesis receptor-like kinase-like protein [Glycine max].

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADELSGPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
1-516 PTHR24420:SF351,SUBFAMILY NOT NAMED

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADEL

HMMPanther: PTHR24420
1-516 PTHR24420,FAMILY NOT NAMED

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADEL

HMMPanther: PTHR24420:SF351
1-516 PTHR24420:SF351,SUBFAMILY NOT NAMED

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADEL

HMMPanther: PTHR24420
1-516 PTHR24420,FAMILY NOT NAMED

MDRVTSSFMGSFFVWAILVLDLVLKASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNNPDLIQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWEQWQKDETFRQDFNSNIHHPNANWIVDSTSHIQADEL

superfamily: SSF52058
25-101 SSF52058,LRR

KASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFY

superfamily: SSF52058
25-101 SSF52058,LRR

KASGNQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFY

HMMPfam: PF08263
IPR013210
29-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCN

HMMPfam: PF08263
IPR013210
29-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NQEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
30-104 G3DSA:3.80.10.10

QEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNN

Gene3D: G3DSA:3.80.10.10
30-104 G3DSA:3.80.10.10

QEGDALNALKSNLQDPNNVLQSWDATLVNPCTWFHVTCNSDNSVTRVDLGNADLSGQLVPELGQLTNLQYFYQNN

Gene3D: G3DSA:2.60.120.200
IPR013320
108-219 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

IQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGS

Gene3D: G3DSA:2.60.120.200
IPR013320
108-219 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

IQPKNTPSPVSPTPPAASSGNSNTGAIAGGVAAGAALLFAAPAIALAYWRRRKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGS

superfamily: SSF56112
IPR011009
166-478 Kinase_like
Protein kinase-like domain

FDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEK

superfamily: SSF56112
IPR011009
166-478 Kinase_like
Protein kinase-like domain

FDVPAEEDPEVHLGQLKRFSLRELQVATDNFSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEK

ProfileScan: PS50011
IPR000719
196-480 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWE

ProfileScan: PS50011
IPR000719
196-480 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRMLEGDGLAEKWE

HMMPfam: PF00069
IPR017442
198-467 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVV

HMMPfam: PF00069
IPR017442
198-467 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVV

PatternScan: PS00107
IPR017441
202-224 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

PatternScan: PS00107
IPR017441
202-224 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGSLVAVK

Gene3D: G3DSA:3.30.200.20
220-274 G3DSA:3.30.200.20

LVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMA

Gene3D: G3DSA:3.30.200.20
220-274 G3DSA:3.30.200.20

LVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMA

Gene3D: G3DSA:1.10.510.10
275-470 G3DSA:1.10.510.10

NGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRML

Gene3D: G3DSA:1.10.510.10
275-470 G3DSA:1.10.510.10

NGSVASCLRERQESQPPLGWPERKRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKDRKLETLVDADLHGNYNDEEVEQLIQVALLCTQGSPVERPKMSEVVRML

PatternScan: PS00108
IPR008271
319-331 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

PatternScan: PS00108
IPR008271
319-331 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox