PRGDB00063110 (leucine-rich repeat family protein/protein kinase family protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat family protein/protein kinase family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717118 (EU888312)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max clone 8070602 leucine-rich repeat family protein/protein kinase family protein mRNA, complete cds.

DNA Sequence

ATGAGTTTGATTGGTCTGAGTGCTACAATTATAGTCTCTGATTGCTCCAATTGTGGTCACATTTCCCAAGCTTCTTCAGATGTGGTTCTTGCTGCCATGAATTTTTCCTTTGTCAACATTTGGTCTACAAGGAACAAAATCAGGTTCGAAAACTCTATTAGGCAAATTTCAGGTATGACCTTGTTGGAAATCAAAAGCACTTTGAATGATACTAAGAATGTTCTGAGCAACTGGCAACAGTTTGATGAGTCTCATTGTGCATGGACTGGTATCTCTTGTCATCCTGGTGATGAACAAAGAGTTCGCTCAATAAATCTTCCATACATGCAACTTGGAGGGATTATTTCTCCAAGCATTGGTAAGCTCAGCAGACTACAGAGATTGGCACTTCATCAGAACAGCTTGCATGGAACCATTCCTAATGAACTTACCAATTGTACTGAGCTAAGAGCACTGAACTTGTCTACCAATTTCTTCTCTGGTGAAATTCCCGACATTGGAGTATTAAGCACCTTTGACAAGAACTCGTTTGTTGGCAATGTAGATCTTTGTGGGCGACAAGTCCAAAAGCCATGTCGAACATCACTTGGTTTCCCTGTGGTGCTACCACATGCTGAAAGTGATGAAGCTGCAGGCAAGCCTTCACATTACATGAAGGGGGTGCTAATTGGAGCAATGGCAATTTTGGGTCTCGCACTTGTCATAATCCTTTCATTCCTCTGGACTCGTTTGTTATCAAAGAAGGAACGAGCAGCAAAGAGATACACTGAAGTCAAGAAACAAGCTGATCCAAAAGCAAGCACAAAACTTATTACCTTCCATGGTGATCTGCCATACACATCATCTGAGATCATAGAGAAGCTAGAGTCTCTTGATGAAGAGGATATAGTAGGATCAGGAGGATTTGGTACAGTTTACCGGATGGTGATGAATGATTGTGGTACATTTGCTGTTAAACAGATTGATCGAAGTTGTGAAGGGTCTGATCAAGTGTTTGAAAGGGAACTAGAAATCTTGGGGAGCATCAATCACATAAATCTAGTAAATCTGCGTGGTTACTGCAGGCTCCCTTCTTCGAGGCTCCTTATCTATGACTATTTGGCCATAGGCAGCTTAGATGATCTCTTGCATGAAAATACTCGACAAAGGCAACTACTGAATTGGAGTGATCGCCTAAAGATAGCTCTTGGTTCTGCCCAGGGTTTGGCATACCTGCACCATGAATGCAGCCCAAAAGTTGTTCATTGTAACATAAAATCCAGCAACATCCTCCTTGATGAAAACATGGAGCCTCATATATCTGATTTTGGTCTTGCAAAGCTTTTGGTTGATGAAGAGGCCCATGTTACCACTGTGGTTGCTGGCACATTTGGTTATTTGGCACCAGAGTATCTACAAAGTGGGAGAGCAACTGAGAAGTCGGATGTATATAGCTTTGGAGTTCTATTGCTGGAACTTGTAACTGGAAAGAGGCCAACAGATCCTTCCTTTGTAAAAAGAGGGTTAAATGTGGTTGGTTGGATGAACACATTACTGAGAGAAAACCGATTAGAGGATGTGGTTGACAAAAGATGCACCGATGCAGATGCAGGAACTCTTGAAGTAATTCTTGAGCTGGCTGCAAGATGCACCGATGGAAATGCAGACGATCGTCCATCGATGAACCAGGTGTTGCAGTTGCTGGAACAGGAGGTTATGTCTCCTTGCCCCAGCGAGTTTTACGAGTCTCATTCAGATCATTAA


Protein sequences

Name Description Sequence
leucine-rich repeat family protein/protein kinase family protein leucine-rich repeat family protein/protein kinase family protein [Glycine max].

MSLIGLSATIIVSDCSNCGHISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSPCPSEFYESHSDH

leucine-rich repeat family protein/protein kinase family protein leucine-rich repeat family protein/protein kinase family protein [Glycine max].

MSLIGLSATIIVSDCSNCGHISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSPCPSEFYESHSDH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF873
20-568 PTHR24420:SF873

HISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSP

HMMPanther: PTHR24420
20-568 PTHR24420,FAMILY NOT NAMED

HISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSP

HMMPanther: PTHR24420:SF873
20-568 PTHR24420:SF873

HISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSP

HMMPanther: PTHR24420
20-568 PTHR24420,FAMILY NOT NAMED

HISQASSDVVLAAMNFSFVNIWSTRNKIRFENSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPDIGVLSTFDKNSFVGNVDLCGRQVQKPCRTSLGFPVVLPHAESDEAAGKPSHYMKGVLIGAMAILGLALVIILSFLWTRLLSKKERAAKRYTEVKKQADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSP

superfamily: SSF52058
51-165 SSF52058,LRR

NSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPD

superfamily: SSF52058
51-165 SSF52058,LRR

NSIRQISGMTLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPD

Gene3D: G3DSA:3.80.10.10
60-165 G3DSA:3.80.10.10

TLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPD

HMMPfam: PF08263
IPR013210
60-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISC

Gene3D: G3DSA:3.80.10.10
60-165 G3DSA:3.80.10.10

TLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISCHPGDEQRVRSINLPYMQLGGIISPSIGKLSRLQRLALHQNSLHGTIPNELTNCTELRALNLSTNFFSGEIPD

HMMPfam: PF08263
IPR013210
60-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TLLEIKSTLNDTKNVLSNWQQFDESHCAWTGISC

superfamily: SSF56112
IPR011009
261-561 Kinase_like
Protein kinase-like domain

QADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLL

superfamily: SSF56112
IPR011009
261-561 Kinase_like
Protein kinase-like domain

QADPKASTKLITFHGDLPYTSSEIIEKLESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLL

Gene3D: G3DSA:3.30.200.20
289-366 G3DSA:3.30.200.20

ESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDY

Gene3D: G3DSA:3.30.200.20
289-366 G3DSA:3.30.200.20

ESLDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDY

ProfileScan: PS50011
IPR000719
291-566 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVM

ProfileScan: PS50011
IPR000719
291-566 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LDEEDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVM

HMMPfam: PF00069
IPR017442
294-559 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQ

HMMPfam: PF00069
IPR017442
294-559 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EDIVGSGGFGTVYRMVMNDCGTFAVKQIDRSCEGSDQVFERELEILGSINHINLVNLRGYCRLPSSRLLIYDYLAIGSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQ

PatternScan: PS00107
IPR017441
297-319 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGGFGTVYRMVMNDCGTFAVK

PatternScan: PS00107
IPR017441
297-319 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGGFGTVYRMVMNDCGTFAVK

Gene3D: G3DSA:1.10.510.10
370-571 G3DSA:1.10.510.10

GSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSPCPS

Gene3D: G3DSA:1.10.510.10
370-571 G3DSA:1.10.510.10

GSLDDLLHENTRQRQLLNWSDRLKIALGSAQGLAYLHHECSPKVVHCNIKSSNILLDENMEPHISDFGLAKLLVDEEAHVTTVVAGTFGYLAPEYLQSGRATEKSDVYSFGVLLLELVTGKRPTDPSFVKRGLNVVGWMNTLLRENRLEDVVDKRCTDADAGTLEVILELAARCTDGNADDRPSMNQVLQLLEQEVMSPCPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox