PRGDB00063111 (serine/threonine kinase-like protein)

From PRG Wiki
Jump to: navigation, search
serine/threonine kinase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 212717116 (EU888311)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Glycine max

Comment?

Glycine max clone 8070601 serine/threonine kinase-like protein mRNA, complete cds.

DNA Sequence

ATGCGCATCTTCAAACCCTCTTCAACCCACTTGCTACTTCTATCTCTCTTCACCTTGCTGCTTACCTTTGCAATTGCAAGTGAAGAAACTCCTATATACAGCGCACATGTCTGCACAAGTGGATCCTATTACCAACCCAACACAACATTCCAAACCAACTTGAACATTCTCCTCTCGTCTCTCGTCTCCAACGCCACCCTCCACGACGGCTTCTTCCGCACCACCGTCTCCGAGGTCAAGGGGCTCTTCTTCTGCCGCGGTGACGTCACCCCCTCCCTCTGCCACCACTGCGTCACCGCCGCAGCAAGTAACATCACAATCTACTGCACCAACCAGACAGAGTCCATAATCTGGTACGACCAGTGCACGCTGCGTTACTCCAACAATTCCAACCTCGACAACACGTTCCCAAGTGTTAACTTGATAAATGTAGAGAGCGTCCCCGACTCGGACCTTACCCGGTTCAACAATATTCTCGCATCCACGGTGAACGATATAAAGCATGAGGTCATGGACTCTAATTCGGGAAAGAAATTTGCTACCAAAGAAGTGAATTTCACGAGCTCAGTGAAGCTCTACACCCTGGCGCAGTGCACGCCCGATATGTCCACTTTTGACTGTGACATATGCCTTTCAATGGCCATCAGTACCCTTGGTGATGGAAAACAAGGAGCACAGTCCCTGCTTCCGGGTTGTAATCTTAGATATGAATTGTACCCTTTTTACAATGTTTCCGCCGTATCCATTCAGTCAGAGCTTACCCCTCCCCCTCCCCCTCCATCTTCAGTTGTGGATGATCTTATAGATGTGGAGTCCTTGCAATTTGACTTGGCTATGGTTGAAGCTGCTACAGAAGGGTTCTCAGATGAGAACAAGATTGGCCAAGGTGGATTTGGAGTGGTTTATAAGGGTGTCTTCCCTAACGGACAGGAGATAGCTGTGAAGAGGTTGTCAGTAACCTCCTTGCAGGGTGCTGTAGAGTTCAGGAATGAAGCTGCTCTTGTGGCCAAGCTTCAACATAGAAATTTAGTGAGACTATTGGGATTTTGCTTGGAGGGTTGGGAGAAGATCCTTCTCTATGAATACATACCAAACAAAAGCCTTGATCACTTTCTATTTGATCATGTAAAGCAGAGAGAGTTAGATTGGTCAAGACGCTACAAGATTATACTTGGCATTGCACGAGGAATTCTTTATTTACATGAAGATTCCCAACTTAGAATTATACACCGTGATCTCAAAGCTAGCAATGTTCTATTAGATGAAAATATGATCCCAAAGATTTCAGATTTTGGCATGGCAAAAATTATCCAAGAAGATCATACTCAAGTAAATACAGGAAGGATTGTTGGGACTTTTGGTTACATGTCTCCAGAATATGCAATGCATGGACACTTCTCTGTGAAATCAGATGTGTTCAGCTTTGGTGTCTTAGTTTTGGAGATTGTGAGTGGGAAGAAGAACACTGATTTTTATCAATCAAATCATGCTGATGACCTCTTAAGCCATGCTTGGAAGAATTGGACAGAGAAAACACCTTTGGAGTTTCTGGATCCAACTCTGAGAGGTTCTTATTCAAGAAATGAAGTCAACAGATGCATTCATATTGGTTTATTGTGTGTTCAGGAAAATCCATCTGATAGGCCTTCAATGGCTACCATTGCACTTATGCTAAACAGTTATTCAGTAACCTTGTCAATGCCACGACAACCAGCATCTTTTCTGCGCACAAGAAATCCTAACAGGCTAAACCAAGGGCTTGACGCTAAAATAAATTAA


Protein sequences

Name Description Sequence
serine/threonine kinase-like protein serine/threonine kinase-like protein [Glycine max].

MRIFKPSSTHLLLLSLFTLLLTFAIASEETPIYSAHVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNNSNLDNTFPSVNLINVESVPDSDLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTRNPNRLNQGLDAKIN

serine/threonine kinase-like protein serine/threonine kinase-like protein [Glycine max].

MRIFKPSSTHLLLLSLFTLLLTFAIASEETPIYSAHVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNNSNLDNTFPSVNLINVESVPDSDLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTRNPNRLNQGLDAKIN

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
32-131 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

IYSAHVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNNSN

ProfileScan: PS51473
IPR002902
32-131 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

IYSAHVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNNSN

HMMPfam: PF01657
IPR002902
36-129 Stress-antifung
Gnk2-homologous domain

HVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNN

HMMPfam: PF01657
IPR002902
36-129 Stress-antifung
Gnk2-homologous domain

HVCTSGSYYQPNTTFQTNLNILLSSLVSNATLHDGFFRTTVSEVKGLFFCRGDVTPSLCHHCVTAAASNITIYCTNQTESIIWYDQCTLRYSNN

ProfileScan: PS51473
IPR002902
135-241 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

TFPSVNLINVESVPDSDLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPF

ProfileScan: PS51473
IPR002902
135-241 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

TFPSVNLINVESVPDSDLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPF

HMMPfam: PF01657
IPR002902
151-241 Stress-antifung
Gnk2-homologous domain

DLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPF

HMMPfam: PF01657
IPR002902
151-241 Stress-antifung
Gnk2-homologous domain

DLTRFNNILASTVNDIKHEVMDSNSGKKFATKEVNFTSSVKLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPF

HMMPanther: PTHR24420
191-578 PTHR24420,FAMILY NOT NAMED

KLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTR

HMMPanther: PTHR24420:SF430
191-578 PTHR24420:SF430,SUBFAMILY NOT NAMED

KLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTR

HMMPanther: PTHR24420
191-578 PTHR24420,FAMILY NOT NAMED

KLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTR

HMMPanther: PTHR24420:SF430
191-578 PTHR24420:SF430,SUBFAMILY NOT NAMED

KLYTLAQCTPDMSTFDCDICLSMAISTLGDGKQGAQSLLPGCNLRYELYPFYNVSAVSIQSELTPPPPPPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTR

superfamily: SSF56112
IPR011009
259-581 Kinase_like
Protein kinase-like domain

PPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTRNPN

superfamily: SSF56112
IPR011009
259-581 Kinase_like
Protein kinase-like domain

PPSSVVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSVTLSMPRQPASFLRTRNPN

Gene3D: G3DSA:3.30.200.20
274-363 G3DSA:3.30.200.20

QFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYI

Gene3D: G3DSA:3.30.200.20
274-363 G3DSA:3.30.200.20

QFDLAMVEAATEGFSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYI

ProfileScan: PS50011
IPR000719
287-562 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS

ProfileScan: PS50011
IPR000719
287-562 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS

HMMPfam: PF07714
IPR001245
290-556 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIAL

HMMPfam: PF07714
IPR001245
290-556 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKIGQGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKILLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIAL

PatternScan: PS00107
IPR017441
293-315 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGVVYKGVFPNGQEIAVK

PatternScan: PS00107
IPR017441
293-315 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGVVYKGVFPNGQEIAVK

Gene3D: G3DSA:1.10.510.10
364-554 G3DSA:1.10.510.10

PNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATI

Gene3D: G3DSA:1.10.510.10
364-554 G3DSA:1.10.510.10

PNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASNVLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGVLVLEIVSGKKNTDFYQSNHADDLLSHAWKNWTEKTPLEFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATI

PatternScan: PS00108
IPR008271
408-420 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL

PatternScan: PS00108
IPR008271
408-420 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox