PRGDB00063123 (disease-resistance protein RAR1)

From PRG Wiki
Jump to: navigation, search
disease-resistance protein RAR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 226525451 (FJ825756)
Gene Class Unknown
Domain Type
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum disease-resistance protein RAR1 gene, partial cds.

DNA Sequence

GCACACCAATCCAGTCCTCTAAGCAGGGTGTGGGAGTTGATGCATGTGCAAGGTGTCGTCAAGGTTTCTTTTGCTCTGATCATGGATCACAGCCCAAGCCACAAAAACCAGCTGCTACTGATGATACAAACAAGGAGCCTGTTGAGAAATCCTCTGTCCCACCGCCCAAGAAAAGGATTGTTAATATAAATGAACCGAGGATATGTAAAAATAAAGGATGTGGTAAATCCTACAAGGAGAAGGATAACCATGATTCTGCTTGTGACTACCATCCAGGTCCTGCCGTTTTCCATGACAGGATGAGAGGG


Protein sequences

Name Description Sequence
disease-resistance protein RAR1 disease-resistance protein RAR1 [Saccharum officinarum].

TPIQSSKQGVGVDACARCRQGFFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

disease-resistance protein RAR1 disease-resistance protein RAR1 [Saccharum officinarum].

TPIQSSKQGVGVDACARCRQGFFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12621
22-102 PTHR12621,CYSTEINE AND HISTIDINE-RICH DOMAIN (CHORD)-CONTAINING PROTEIN

FFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

HMMPanther: PTHR12621:SF1
22-102 PTHR12621:SF1,RAR1

FFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

HMMPanther: PTHR12621
22-102 PTHR12621,CYSTEINE AND HISTIDINE-RICH DOMAIN (CHORD)-CONTAINING PROTEIN

FFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

HMMPanther: PTHR12621:SF1
22-102 PTHR12621:SF1,RAR1

FFCSDHGSQPKPQKPAATDDTNKEPVEKSSVPPPKKRIVNINEPRICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

HMMPfam: PF04968
IPR007051
67-102 CHORD
Cysteine/histidine-rich domain

ICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

HMMPfam: PF04968
IPR007051
67-102 CHORD
Cysteine/histidine-rich domain

ICKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

ProfileScan: PS51401
IPR007051
68-102 CHORD
Cysteine/histidine-rich domain

CKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG

ProfileScan: PS51401
IPR007051
68-102 CHORD
Cysteine/histidine-rich domain

CKNKGCGKSYKEKDNHDSACDYHPGPAVFHDRMRG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox