PRGDB00063124 (disease-resistance protein SGT1)

From PRG Wiki
Jump to: navigation, search
disease-resistance protein SGT1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 226525449 (FJ825755)
Gene Class Unknown
Domain Type
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum disease-resistance protein SGT1 gene, partial cds.

DNA Sequence

GTGGAATCCAATGGCACTGTTCTCTCAACCAATTGGAAAGATGTTGGATCAAAGGTGGTGGAAGGGAGCCCTCCTGATGGAATGGAGCTGAAGAGAGAAGGAAGAAAAACTTGATGGTGATGCTGCATTGAACAAATTCTTCCGGGACATCTACAAGGATGCCGATGAAGATATGCGGAGGGCCATGATGAAGTCATTC


Protein sequences

Name Description Sequence
disease-resistance protein SGT1 disease-resistance protein SGT1 [Saccharum officinarum].

EKEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

disease-resistance protein SGT1 disease-resistance protein SGT1 [Saccharum officinarum].

EKEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

Domains

Domain Start-End Description Sequence

ProfileScan: PS51048
IPR007699
1-66 SGS
SGS

EKEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

ProfileScan: PS51048
IPR007699
1-66 SGS
SGS

EKEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPfam: PF05002
IPR007699
2-66 SGS
SGS

KEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPfam: PF05002
IPR007699
2-66 SGS
SGS

KEEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPanther: PTHR22904:SF69
3-66 PTHR22904:SF69,SUBFAMILY NOT NAMED

EEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPanther: PTHR22904
3-66 PTHR22904,TPR REPEAT CONTAINING PROTEIN

EEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPanther: PTHR22904:SF69
3-66 PTHR22904:SF69,SUBFAMILY NOT NAMED

EEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK

HMMPanther: PTHR22904
3-66 PTHR22904,TPR REPEAT CONTAINING PROTEIN

EEKLDGDAALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKVVEGSPPDGMELK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox