PRGDB00063171 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 329762913 (HQ425641)
Gene Class Unknown
Domain Type
Gene Species Dimocarpus longan

Comment?

Dimocarpus longan cultivar Honghezi hypothetical protein mRNA, partial cds.

DNA Sequence

GGTGGTGGTTGATGATATATGGAGATTTGACATTAAGTGATGACAGAGAAAGCAATGGTGTCATAAATTTTACTGAGGAGAGAGATAGTATAGTAATCGACACCAACAAAACGACGACGTCTGAGAGCAATAATTTGAGTACCAATGGAGGCAGTGGGGACTCGTACTCTTGCTCTTCAATAACTTCGTGGAATTTTGATGATGGTGGGATTGATTGGGACTGGGAGAGTGTTGGCTTACCACTCGCGAT


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Dimocarpus longan].

WWLMIYGDLTLSDDRESNGVINFTEERDSIVIDTNKTTTSESNNLSTNGGSGDSYSCSSITSWNFDDGGIDWDWESVGLPLA

hypothetical protein hypothetical protein [Dimocarpus longan].

WWLMIYGDLTLSDDRESNGVINFTEERDSIVIDTNKTTTSESNNLSTNGGSGDSYSCSSITSWNFDDGGIDWDWESVGLPLA







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox