PRGDB00063206 (unnamed protein product)

From PRG Wiki
Jump to: navigation, search
unnamed protein product
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270236334 (FN595516)
Gene Class Unknown
Domain Type
Gene Species Vitis vinifera

Comment?

Vitis vinifera, whole genome shotgun sequence of line PN40024, scaffold_149.assembly12x.

DNA Sequence

ATGGCAGCAACGTCAGCGCCGCTCTCCAAGCCCGGTAGCCAGGGATCGTCGGAGAGATACGGATCGGAGAGCGGCGCGGAGGAGAAGGCCCAGCGTGCGACTTTCGAGTATTTTGGATGGGTTTATCATCTGGGGGTCAATTCTATTGGGCGTGAGTACTGCCATCTTCGTTTCTTGTTTGTCAGGGGCAAGTATATGGAGATGTACAAGCGCGATCCCCACCAGTTTCCCGGCATTAAACCGATTAGGAGGGGTGTTGTAGGATATACACTCACAGTAGAGGAGCTTGGACGGCGGAAGCTCAACGGTGGGGATATTTATGTTCTGCGCTTGTACAACCGGTTGGATGAGACAAGAAAGGGTGAAATTGCTTGTGCTTCAGCTGGAGAAGCTCGAAAATGGATGGAAGCATTTGATCATGCCAAGCAACAGGCTGAATACGAGCTGTCAAGAGGAAGTGGTGCCAGAAATAAACTGAACATGGAAACTGAGATCAATCTTGAAGGGCATCGACATTCTGTGCGGCGGTATGCACATGGTTTGAAAGAGCTTATAAAAATTGGACAAGGCCCTGAGTCACTTTTGCGACAATCCTCAAACTTGGGTGTCAAAGTGAGGTCGGATGGGTACATTGAAGGGGATGGGGGTGATGCAATTGAAGCACACGAATGGAAATGTGTCCGTACAATTGATGGTGTTAGGATCTTTGAGGATGTTGCTGCTTCTCAGAGTGGTAAAGGTGTCCTCACGAAATCTGTTGGTGTTATTGATGCAAATGCAGATATTGTTTTTGAAGTGCTCCTAAACCTTGATCGGCATCAAAGATATGAGTGGGACATGTTGACAGTTGATTTGGAGCTAGTAGATTCTTTGGATGGGCACTATGATATTGTCTACGGAACATATGATCCAAAATATTTTCCTGGTTGGTACTCAAAGAGGGACTTTGTCCTTGCAAGGCAATGGTTTCGTGGACAAGATGGAACCTATACAATCTTGCAATTTCCTTCCACACATAAGAAGCGACCTCCAAGATCTGGATATCGACGAACAAAAATTAATCCTTCTACATGGGAAATCAGAAGGTTAAATACCCCTATGGCTTCAAACACTGCAAGATGTCTTGTGACACACACATTAGAGATGCCTTCTACTAGCTGGTTTACATGGAAGAATAATCACCATTCGAAATTTGAAAATTCTGTTCCTTTTGTGTTACTATGCCAAGTAGCAGGTCTGAAGGAATATATTGGAGCCAATCCTGCTCTAAAATTTGAAGCTTCCACCACTGTTGTCCATTCTACTAGCTCTGAAGTTTCTGTTTCCAATACCGAATATGAGGATACTGAAGTGCGGGATGAGTTCTATGATGCAATTGCTGGTGATTCATTATCTGAAGATGAAGATAGTGACGATGACAATGATGCAGAACTCGACAATGATGCAGAACTTGACAAGAAGGATAAAAAAGTGAAGCTGAAGAATGTTTCATGGGCCATCACAAGCTTAGCTTTGAAGAGAATTTCAGCTCTAGATGCAAATAAGGAACTTGATCCGAATGCATCTCCTGTCAATGTCGATCCAAGCCAATTCCACTGTTCAATGCACCAAGGGAAGGATAAAAAGGACACAAATTGCTGGACTACTCTGGATGGTGCAGGATTTATGATCAGAGGAAAGACTTACCTAGAAGATAATTATAAGGTAATGGGAGGAGATCCCCTTCTCAAGCTCATAGCAGTTGATTGGTTTAAAGCTGATAATACAATGAATAAGATTGCATTGCATCCCAAATCTCTTGTTCAGTGCGAAGCTGGAAAAAAGCTCCCATTTATTCTCATCATTAATCTTGAGATTCCAGCAAAACCAAACTATAGTCTGGTTCTCTACTATGCTGCTGACAGGCCAGTGAATAAAAATTCCTTATTGGGTAAATTTGTGGATGGAACTGACATGTTTCGAGATTCAAGGTTCAAACTCATTCCAAGTATCGTGGAGGGTTATTGGATGGTCAAGCGCGCTGTAGGCACAAAAGCTTGCCTCTTGGGGAAAGCAGTGACCTGCAAATACCTCAGACAAGACAATTTTCTGGAGATTGATGTAGATATTGGCTCATCATCAGTAGCAAGGAGTATCATTGGTCTTGTCCTGGGGTATGTCACAAGCATAGTGGTGGATCTTGCAATTTTAATAGAGGCAAAAGAAGAGACAGAACTACCTGAGTACATTCTTGGCACTATTAGACTGAATCGTGTGAAGCTTGACTCTGCCATACCCTTACAGGGTTGA


Protein sequences

Name Description Sequence
unnamed protein product unnamed protein product [Vitis vinifera].

MAATSAPLSKPGSQGSSERYGSESGAEEKAQRATFEYFGWVYHLGVNSIGREYCHLRFLFVRGKYMEMYKRDPHQFPGIKPIRRGVVGYTLTVEELGRRKLNGGDIYVLRLYNRLDETRKGEIACASAGEARKWMEAFDHAKQQAEYELSRGSGARNKLNMETEINLEGHRHSVRRYAHGLKELIKIGQGPESLLRQSSNLGVKVRSDGYIEGDGGDAIEAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEMPSTSWFTWKNNHHSKFENSVPFVLLCQVAGLKEYIGANPALKFEASTTVVHSTSSEVSVSNTEYEDTEVRDEFYDAIAGDSLSEDEDSDDDNDAELDNDAELDKKDKKVKLKNVSWAITSLALKRISALDANKELDPNASPVNVDPSQFHCSMHQGKDKKDTNCWTTLDGAGFMIRGKTYLEDNYKVMGGDPLLKLIAVDWFKADNTMNKIALHPKSLVQCEAGKKLPFILIINLEIPAKPNYSLVLYYAADRPVNKNSLLGKFVDGTDMFRDSRFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCKYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTSIVVDLAILIEAKEETELPEYILGTIRLNRVKLDSAIPLQG

Domains

Domain Start-End Description Sequence

superfamily: SSF55961
220-382 Bet v1-like

EAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEM

Gene3D: G3DSA:3.30.530.20
IPR023393
220-419 no description
START-like domain

EAHEWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTHTLEMPSTSWFTWKNNHHSKFENSVPFVLLCQVAGLKEYIGA

HMMPanther: PTHR12136
223-364 FAMILY NOT NAMED,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

EWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLN

HMMPanther: PTHR12136:SF13
223-364 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EWKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLN

ProfileScan: PS50848
IPR002913
224-377 START
Lipid-binding START

WKCVRTIDGVRIFEDVAASQSGKGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVT

HMMPfam: PF01852
IPR002913
246-378 START
Lipid-binding START

KGVLTKSVGVIDANADIVFEVLLNLDRHQRYEWDMLTVDLELVDSLDGHYDIVYGTYDPKYFPGWYSKRDFVLARQWFRGQDGTYTILQFPSTHKKRPPRSGYRRTKINPSTWEIRRLNTPMASNTARCLVTH

Seg: seg
426-447 seg

EASTTVVHSTSSEVSVSNTEYE

Seg: seg
462-494 seg

DSLSEDEDSDDDNDAELDNDAELDKKDKKVKLK

HMMPfam: PF07059
IPR009769
547-752 DUF1336
Domain of unknown function DUF1336

WTTLDGAGFMIRGKTYLEDNYKVMGGDPLLKLIAVDWFKADNTMNKIALHPKSLVQCEAGKKLPFILIINLEIPAKPNYSLVLYYAADRPVNKNSLLGKFVDGTDMFRDSRFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCKYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTSIVVDLAILIEAKEETELPEYILGTIRLNRV


List of References

Olivier Jaillon, Jean-Marc Aury, Benjamin Noel, Alberto Policriti, Christian Clepet, Alberto Casagrande, Nathalie Choisne, Sébastien Aubourg, Nicola Vitulo, Claire Jubin, Alessandro Vezzi, Fabrice Legeai, Philippe Hugueney, Corinne Dasilva, David Horner, Erica Mica, Delphine Jublot, Julie Poulain, Clémence Bruyère, Alain Billault, Béatrice Segurens, Michel Gouyvenoux, Edgardo Ugarte, Federica Cattonaro, Véronique Anthouard, Virginie Vico, Cristian Del Fabbro, Michaël Alaux, Gabriele Di Gaspero, Vincent Dumas, Nicoletta Felice, Sophie Paillard, Irena Juman, Marco Moroldo, Simone Scalabrin, Aurélie Canaguier, Isabelle Le Clainche, Giorgio Malacrida, Eléonore Durand, Graziano Pesole, Valérie Laucou, Philippe Chatelet, Didier Merdinoglu, Massimo Delledonne, Mario Pezzotti, Alain Lecharny, Claude Scarpelli, François Artiguenave, M Enrico Pè, Giorgio Valle, Michele Morgante, Michel Caboche, Anne-Françoise Adam-Blondon, Jean Weissenbach, Francis Quétier, Patrick Wincker, French-Italian Public Consortium for Grapevine Genome Characterization
The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
Nature: 2007, 449(7161);463-7
PubMed:17721507 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox