PRGDB00063211 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4587641 (AC005287)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome I BAC F20D21 genomic sequence, complete sequence.

DNA Sequence

ATGAAAGGGAAGCGTTTCTTGGGCCAATACTTGATATGGGTGATATTATTGTTGGGGCAGCTCCATGAATGCAAAAGCTGCATTGAGAAAGAAAGAGTAGCTTTGTTGGATTTTAAGAAATATTGGATGTCCATTACGCAAGAATCGGACTTGGACTATGTTTTCCCTACTTGGAATAATGACACAAAGAGCGATTGTTGCCAGTGGGAGAGCATTATGTGCAATCCTACAAGTGGGCGGCTTATCAGGCTTCACGTTGGTGCTTCGAATTTAAAAGAGAATTCTCTACTAAATATTTCTTTACTGCATCCCTTTGAAGAGGTTCGAAGTCTAGAATTATCAGCTGGGCTCAATGGCTTCGTTGATAATGTTGAAGGTTATAAAAGCTTAAGGAAATTAAAAAATTTGGAGATTCTGGATCTCTCTTATAATAATAGATTCAACAACAACATACTTCCATTTATTAATGCTGCTACGTCACTTACAAGCCTTTCTCTTCAAAATAACTCCATGGAAGGCCCTTTCCCTTTTGAAGAAATAAAAGACTTGACAAACTTGAAACTATTGGATCTTAGTAGAAACATACTAAAAGGCCCCATGCAAGGTAGATTAAACAAGCTAAGGGTTCTTGATTTGTCATCCAACCAGCTAAATGGAAATCTACCATCTACTTTCAACAGACTCGAGTCCCTTGAATATCTATCATTATTAGATAACAACTTCACCGGCTTCTTCTCATTTGATCCACTCGCCAACCTCACAAAGCTTAAGGTGTTCAAACTTTCATCAACATCAGATATGTTGCAAATCAAGACAGAGATGCATGAGTTGCAGTTCTTGGATTTTTCAGTGAATGATATTAGTGGACTGCTCCCTGATAATATCGGTTATGCGCTTCCGAATCTGTTACGAATGAACGGCTCAAGAAATGGGTTTCAAGGGCATTTACCATCTTCTATGGGTGAGATGGTAAACATTACATCCCTTGATCTATCTTATAATAACTTCTCCGGGAAGCTACCTAGACGCTTTGTCACTGGTTGTTTTTCACTAAAACACTTGAAGCTCTCCCACAACAATTTTAGTGGCCATTTTCTTCCAAGAGAAACAAGCTTTACTTCCCTGGAAGAGTTGAGAGTTGATAGCAACTCATTCACTGGGAAGATCGGAGTTGGTTTGCTTAGCTCCAACACTACGTTATCAGTTCTTGACATGTCCAACAATTTTCTAACGGGTGATATTCCAAGCTGGATGTCTAACTTATCTGGTTTAACTATCTTGTCGATATCAAACAATTTTTTAGAAGGTACGATACCACCATCTTTGCTAGCCATTGGCTTTCTTTCTCTCATCGACCTATCGGGAAACTTATTATCTGGATCCTTACCGTCACGTGTTGGTGGGGAGTTTGGGATAAAATTGTTCCTACACGACAACATGCTCACGGGGCCGATTCCAGACACGTTGTTGGAAAAGGTCCAAATACTTGATTTACGGTACAATCAACTTTCTGGGAGTATTCCACAATTTGTCAATACCGAGAGCATATATATTCTTTTAATGAAGGGAAACAACTTAACAGGATCTATGTCAAGGCAGCTCTGTGATTTGAGAAATATCAGACTTTTAGATCTTTCAGATAACAAGCTCAATGGCTTCATACCTTCATGTCTATATAATTTATCATTTGGACCAGAGGATACAAATTCATATGTAGGTACAGCCATAACGAAGATTACTCCGTTCAAGTTTTACGAATCCACATTTGTGGTAGAGGATTTTGTGGTAATATCCTCTAGTTTTCAAGAAATTGAAATCAAATTTTCAATGAAGCGAAGGTATGATTCTTATTTTGGAGCAACTGAATTCAACAATGACGTACTTGATTATATGTATGGAATGGACCTATCAAGCAATGAGTTAAGTGGGGTTATCCCAGCAGAGCTTGGAAGTCTCTCAAAGCTACGAGTCATGAATTTATCTTGCAACTTCTTGTCCAGTTCAATACCATCTAGCTTCTCCAATCTCAAGGATATTGAGAGCCTTGACCTTTCGCATAACATGTTACAAGGAAGTATTCCTCAACAACTAACCAACCTTTCTTCTCTTGTTGTCTTTGATGTGTCTTACAATAATTTATCCGGAATCATTCCCCAAGGAAGGCAGTTTAATACCTTTGACGAGAAAAGCTACTTGGGAAATCCTCTTCTTTGTGGACCACCGACCAATAGAAGTTGTGATGCTAAGAAGACCTCAGATGAATCAGAAAATGGAGGAGAAGAAGAAGATGATGAAGCTCCTGTTGATATGTTGGCCTTCTATTTTAGTAGTGCTTCGACTTATGTAACTACATTGATAGGCATTTTTATACTTATGTGCTTTGATTGTCCTTTGCGTCGAGCATGGCTCCGCATTGTCGATGCTTCCATCGCCTCAGTCAAAAGTATGTTGCCTTAA


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Arabidopsis thaliana].

MKGKRFLGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTEMHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAWLRIVDASIASVKSMLP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-802 PTHR24420,FAMILY NOT NAMED

YLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTEMHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

HMMPanther: PTHR24420:SF914
10-802 PTHR24420:SF914

YLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSSTSDMLQIKTEMHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSCDAKKTSDESENGGEEEDDEAPVDMLAFYFSSASTYVTTLIGIFILMCFDCPLRRAW

superfamily: SSF52058
25-263 SSF52058,LRR

KSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLSS

Gene3D: G3DSA:3.80.10.10
28-256 G3DSA:3.80.10.10

IEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCNPTSGRLIRLHVGASNLKENSLLNISLLHPFEEVRSLELSAGLNGFVDNVEGYKSLRKLKNLEILDLSYNNRFNNNILPFINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSRNILKGPMQGRLNKLRVLDLSSNQLNGNLPSTFNRLESLEYLSLLDNNFTGFFSFDPLANLTKL

HMMPfam: PF08263
IPR013210
30-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWESIMCN

HMMPfam: PF00560
IPR001611
206-227 LRR_1
Leucine-rich repeat

KLRVLDLSSNQLNGNLPSTFNR

FPrintScan: PR00019
207-220 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLNGN

Gene3D: G3DSA:3.80.10.10
257-461 G3DSA:3.80.10.10

KVFKLSSTSDMLQIKTEMHELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGS

superfamily: SSF52058
275-562 SSF52058,LRR

HELQFLDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHFLPRETSFTSLEELRVDSNSFTGKIGVGLLSSNTTLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLLSGSLPSRVGGEFGIKLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLS

HMMPfam: PF00560
IPR001611
325-344 LRR_1
Leucine-rich repeat

NITSLDLSYNNFSGKLPRRF

HMMPfam: PF00560
IPR001611
400-421 LRR_1
Leucine-rich repeat

LSVLDMSNNFLTGDIPSWMSNL

HMMPfam: PF00560
IPR001611
424-443 LRR_1
Leucine-rich repeat

LTILSISNNFLEGTIPPSLL

Gene3D: G3DSA:3.80.10.10
473-566 G3DSA:3.80.10.10

KLFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPE

superfamily: SSF52058
474-746 SSF52058,LRR

LFLHDNMLTGPIPDTLLEKVQILDLRYNQLSGSIPQFVNTESIYILLMKGNNLTGSMSRQLCDLRNIRLLDLSDNKLNGFIPSCLYNLSFGPEDTNSYVGTAITKITPFKFYESTFVVEDFVVISSSFQEIEIKFSMKRRYDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPTNRSC

HMMPfam: PF00560
IPR001611
493-510 LRR_1
Leucine-rich repeat

VQILDLRYNQLSGSIPQF

Gene3D: G3DSA:3.80.10.10
634-742 G3DSA:3.80.10.10

MDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQGRQFNTFDEKSYLGNPLLCGPPT

HMMPfam: PF13855
635-689 LRR_8,Leucine rich repeat

DLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSFSNLKDIESLDLSHNML

FPrintScan: PR00019
676-689 LEURICHRPT,Leucine-rich repeat signature

LKDIESLDLSHNML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox