PRGDB00063239 (NBS-LRR resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 258642378 (GQ480403)
Gene Class N
Domain Type NBS, Others
Gene Species Hevea brasiliensis

Comment?

Hevea brasiliensis clone HevRTRGA6 NBS-LRR resistance protein mRNA, partial cds.

DNA Sequence

GGTGTAGGAAAAACCACCATCTCCAAGAAAATTTTTAATGATACTGTTGTACGCGATCATTTTAATCAGAAGATATGGGTGTCAGTGTCTTCGAGTTTTAGAATGGAGGTGATCTTGAGAAGCATCTTGGAACAATCAGGAGAAAAATCTGTAGAACAATCACAGGAGGGTGGCCAATCAGGACAAATATCAGCAGTGGCTGATCAGAGTCAATTGTTACATAAAGTTATTTCTCTGTTAAAAGAAAAAACTTGTCTCATTATTTTCGATGATATCTGGGGGGAGAAGGGGGGTCTTGATTTGTGGAAGAAATTTTTTTCCTCCGATCTTCCGGAGTCAGATTGTAAAAGAAGTTGCTTTATTATCACCACAAGAAACAAAGATGTTACATCTGCTATCACAGCCGATGAAATTCATCAGCCAAGTTTTCTTGATGATGAAAAAAGTTGGTTATTGTTCTCTAAGCATGCATTTCGCAAGATTCAGGAGCAAAGCCTTCGTGAAAAATTTGAAGAAGTGGGCAAGTTAATTGTGTCCAAATGTGGGGGACTGCCCCTCGCCCTC


Protein sequences

Name Description Sequence
NBS-LRR resistance protein NBS-LRR resistance protein [Hevea brasiliensis].

GVGKTTISKKIFNDTVVRDHFNQKIWVSVSSSFRMEVILRSILEQSGEKSVEQSQEGGQSGQISAVADQSQLLHKVISLLKEKTCLIIFDDIWGEKGGLDLWKKFFSSDLPESDCKRSCFIITTRNKDVTSAITADEIHQPSFLDDEKSWLLFSKHAFRKIQEQSLREKFEEVGKLIVSKCGGLPLAL

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
1-133 G3DSA:3.40.50.300

GVGKTTISKKIFNDTVVRDHFNQKIWVSVSSSFRMEVILRSILEQSGEKSVEQSQEGGQSGQISAVADQSQLLHKVISLLKEKTCLIIFDDIWGEKGGLDLWKKFFSSDLPESDCKRSCFIITTRNKDVTSAI

HMMPfam: PF00931
IPR002182
1-188 NB-ARC,NBS
NB-ARC

GVGKTTISKKIFNDTVVRDHFNQKIWVSVSSSFRMEVILRSILEQSGEKSVEQSQEGGQSGQISAVADQSQLLHKVISLLKEKTCLIIFDDIWGEKGGLDLWKKFFSSDLPESDCKRSCFIITTRNKDVTSAITADEIHQPSFLDDEKSWLLFSKHAFRKIQEQSLREKFEEVGKLIVSKCGGLPLAL

superfamily: SSF52540
1-188 SSF52540

GVGKTTISKKIFNDTVVRDHFNQKIWVSVSSSFRMEVILRSILEQSGEKSVEQSQEGGQSGQISAVADQSQLLHKVISLLKEKTCLIIFDDIWGEKGGLDLWKKFFSSDLPESDCKRSCFIITTRNKDVTSAITADEIHQPSFLDDEKSWLLFSKHAFRKIQEQSLREKFEEVGKLIVSKCGGLPLAL

FPrintScan: PR00364
IPR000767
79-93 DISEASERSIST
Disease resistance protein

LLKEKTCLIIFDDIW

FPrintScan: PR00364
IPR000767
181-188 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox