PRGDB00063240 (NBS-LRR resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 258642376 (GQ480402)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hevea brasiliensis

Comment?

Hevea brasiliensis clone HevRTRGA4 NBS-LRR resistance protein mRNA, partial cds.

DNA Sequence

GGCGTTGGAAAAACCACTCTTTCGCAGATTGTCTACAATGACAGCAGAGTAGTGGATTGGTTTGATTTAAAAGTTTGGTGTTGTGTTTCTGAGGACTTTGATGTTGTTAGGGTGACAAAAACGATTCTTGAGGCCATAACTATGAAGGATTTCAATATAAAGGATTTAAATTTGCTTCAAGTGGCATTGAGGGAACAATTGAGGGGGAAGAGGTATTTGATTGTTTTAGACGATGTTTGGAGTGAGAAGTATGAGGATTGGACTGTGCTTCGTCAGCCTTTCCAAGTGGGATCTCCATGCAGTAAAATTATTGTCACTACACGTAATCATGGTGTTGCAGCAATTATGGGTACCGTTGAAGGTCACTTTTTGAAGGAGCTATCAGTTGACAATTGTCTGTCTTTGTTTGCAATGCATGCATTAGGAAGAAGAAACTTTGATGGTCACTTGAATCTAAAGGAGATTGGTGAGAAGATAGTTCGGAAATGTGGAGGACTCCCCCTAGCTCTC


Protein sequences

Name Description Sequence
NBS-LRR resistance protein NBS-LRR resistance protein [Hevea brasiliensis].

GVGKTTLSQIVYNDSRVVDWFDLKVWCCVSEDFDVVRVTKTILEAITMKDFNIKDLNLLQVALREQLRGKRYLIVLDDVWSEKYEDWTVLRQPFQVGSPCSKIIVTTRNHGVAAIMGTVEGHFLKELSVDNCLSLFAMHALGRRNFDGHLNLKEIGEKIVRKCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-170 NB-ARC,NBS
NB-ARC

GVGKTTLSQIVYNDSRVVDWFDLKVWCCVSEDFDVVRVTKTILEAITMKDFNIKDLNLLQVALREQLRGKRYLIVLDDVWSEKYEDWTVLRQPFQVGSPCSKIIVTTRNHGVAAIMGTVEGHFLKELSVDNCLSLFAMHALGRRNFDGHLNLKEIGEKIVRKCGGLPLAL

superfamily: SSF52540
1-170 SSF52540

GVGKTTLSQIVYNDSRVVDWFDLKVWCCVSEDFDVVRVTKTILEAITMKDFNIKDLNLLQVALREQLRGKRYLIVLDDVWSEKYEDWTVLRQPFQVGSPCSKIIVTTRNHGVAAIMGTVEGHFLKELSVDNCLSLFAMHALGRRNFDGHLNLKEIGEKIVRKCGGLPLAL

HMMPanther: PTHR23155:SF236
1-94 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

GVGKTTLSQIVYNDSRVVDWFDLKVWCCVSEDFDVVRVTKTILEAITMKDFNIKDLNLLQVALREQLRGKRYLIVLDDVWSEKYEDWTVLRQPF

HMMPanther: PTHR23155
1-94 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTLSQIVYNDSRVVDWFDLKVWCCVSEDFDVVRVTKTILEAITMKDFNIKDLNLLQVALREQLRGKRYLIVLDDVWSEKYEDWTVLRQPF

FPrintScan: PR00364
IPR000767
66-80 DISEASERSIST
Disease resistance protein

QLRGKRYLIVLDDVW

FPrintScan: PR00364
IPR000767
163-170 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox