PRGDB00063245 (P-loop NTPase)

From PRG Wiki
Jump to: navigation, search
P-loop NTPase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 310686085 (HM562671)
Gene Class NL
Domain Type NBS, LRR
Gene Species Vitis aestivalis

Comment?

Vitis aestivalis clone pSCA8(W3-R2) P-loop NTPase gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACTATTGCCAAGGCTATTTATAATGAGATCTTAGATCAATATGATGGTAGGAGCTTTCTTAGAAATATCAGAGAGAGATCCCAAGGTGATATACTTCAGTTACAACAAGAACTTCTTCATGGTATCCTAAGGGGAAAAAATTTTAACATAAACAATGTTGATGAAGGAATTAGTATGATAAAGAGGTGTCTAACCTCCAATAGAGTTCTTGTTATTTTTTATGATGTGGATGAGTTGAAACAACTAGAATATTTGGCTGAAGAGAAAGATTGGTTTCATGCAAAAAGTACAATCATCATTACAACTAGAGACAAACACATGCTTGCTCAATATGGAGCAGATATACCATATGAGGTTTCAAAATTAAACAAGGAAGAAGCAATTGAGCTCTTTAGTTTGTGGGCCTTTAAACAAAATCGTCCCCAAGAAGTTTATAAAAACCTCTCATACAATATCATAGATTATGCTGATGGCCTCCCCTTAGCCC


Protein sequences

Name Description Sequence
P-loop NTPase P-loop NTPase [Vitis aestivalis].

GGVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYGADIPYEVSKLNKEEAIELFSLWAFKQNRPQEVYKNLSYNIIDYADGLPLA

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-168 NB-ARC,NBS
NB-ARC

GGVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYGADIPYEVSKLNKEEAIELFSLWAFKQNRPQEVYKNLSYNIIDYADGLPLA

superfamily: SSF52540
1-168 SSF52540

GGVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYGADIPYEVSKLNKEEAIELFSLWAFKQNRPQEVYKNLSYNIIDYADGLPLA

HMMPanther: PTHR11017:SF20
1-168 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYGADIPYEVSKLNKEEAIELFSLWAFKQNRPQEVYKNLSYNIIDYADGLPLA

HMMPanther: PTHR11017
1-168 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYGADIPYEVSKLNKEEAIELFSLWAFKQNRPQEVYKNLSYNIIDYADGLPLA

Gene3D: G3DSA:3.40.50.300
2-118 G3DSA:3.40.50.300

GVGKTTIAKAIYNEILDQYDGRSFLRNIRERSQGDILQLQQELLHGILRGKNFNINNVDEGISMIKRCLTSNRVLVIFYDVDELKQLEYLAEEKDWFHAKSTIIITTRDKHMLAQYG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox