PRGDB00063248 (RGH2B)

From PRG Wiki
Jump to: navigation, search
RGH2B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20513849 (AF427791)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare Mla locus, complete sequence.

DNA Sequence

ATGTATGGTGTTTGGTTTGCTTCAGGCAGGAACATGGAGATGATGGAGGCGCCGGTGAGTGCATCACAGGGAGCCATGCGGTCCCTTCCGAGAAAGCTCGAGTCTTTGCTATCTGGACCCAATCAGGGGCTCCGGCCGGAGGAGAAGAAGAAGCTGCGCTTCCTCCAAGCAGATCTGCAGGGACTAATCGACAGCTACCTATTTGAGCCGTCGGAGGTGGAGTCCCCTGCCTCGACGGCCAGCTTCTGGATGAAGGATGTGCGCGACCTGTCGTATGACATCGACGACTTCATCTACGAGCTCGGCCACGTTGCCGTCAGCGGTGCCAGGATCGGCGCCGCCCAGATCCAGAAGGTCCCCGGCGTCAAGATCTCTCGGTTCCCGGACAAGCTGAAACGGCGACAGTGGATCTCCGACGAGATCTCGGGTTTCAGGACTCGCGTCAAGGAAGCAATTCAACGGCACAAAACTTATCTTGGTGGCTGCAGATGGCGGCCTAGCAGCAGTAGCAGTCAGCACTCTGCTCCATCACCATGTGGCCGGGCTGCCATTCGCCTTGTTGGTATGGACAGCCCCGTCGAACAGCTCTGCGGCTGGCTGGCTAACGATGGACAGCCGGAGCACAAGGTGGCGTCCATTGTTGGGACTAGTGGGGTTGGGAAGACCACCCTCGCCAGACAAGTTTACCATAAGCTTGGAGGCCAGTTCGAGTGCCGGGCTTTTGTGCAGGCATCGCCAAAACAAGACATGAAGATGCTCCTCACCAGCATACTCTCGCAAGTTCGACGGCACCACCTCCCCGACTCTTTCGACGTGCATAAGCTGCTTTTCGAGATCGAAGCACACCTGCAAGATAAGACGTACATAATTGTAATTGATAATCTGCAGGCGTCATCAACCTGGGATATTATTAATCATGCTTTGCCAAAGGAAAATTGTTGCAGTAGAATATTGACAACCACAGAAGTTGATGCTATAGCTCAGACATGCTGTGCAGATACCTCCAAGTATATCTTCAAGAAGGAATCGCTTAGTGAAGATGAGTCAAGAGAACTGTTTCTAGGTACAGTTTTTGGCCATGAAGCCGGATGTCCTCAGGTTCTCAAGGAAGTTTCAAATGAAATTATAAAAAGAAGTGGTGGCTTGCCGCTAGCAATTATTATATTGGCCAGTCTCTTGGTAGGTCAGCCAGCGAGCAGCATAGAGCACTGGAATCACATAAAGAATTCACTGAGTTCCGATTCAAGCACAAATACTAGTTTGGAAGGGATAAAACAAGTTCTCAACCTTGGCTATGAGTATCTTCCTCACTATCTAAAAGCATGCATGCTATATCTGTGTATGTATGAAGAGGACTGCATAATCTGGAAGGATGATTTGGTGAAGCAGTGGATAGCCGAAGGTTTCATCCATGCAATGGATGGGAACGGTGGGAAGGAAGTTGCACGGAGCTATTTTGATGAACTTGTTAACAGAGGAATGATCCAACCAATGGATATCAACTGCAATGATGAAATTCTTTCATTCAGCGTGCACACCATGGTACTTCACTTCATTAGATACAAGTCCGTAGAAGAGAATTTCAGCATTGCATTAGATCATTCCCAGACCACTATAAGGCTTGCTGACAAAGTTCGTCGGCTGGCTCTCCACTTCGGCAATGTTGAACATGCCACACCGCCAATGCCGGCGAGTATGAGACTGTCACAAGTTCGATCTCTTGCCTTTTCTGGATTGCTCAAGTGCATGCCTTCCTTTGTGGAGTTCCGGTTTATTCAGGTTCTGATCCTTAAATTATGGGCTGACCCTGATAACAGGAGTGACAACTTTATTGGCTCTGATGACCTGAGTGGCAACATCACTGAACCTGATGACTTGAGTGACAATCTCACTGAACATGATGACCTGAGTTTGAATCTAAGTGAAATTTCAGAACTCTTCCGACTGAGGTATTTTCATCTTGATGCATGTCATATGAGTGTGGAGCTTCCAACCCAGATGAAACGGCTAAAAGATTTGGTGGCATGTGAAATTGATGCCAATGTAACTGCAGTCCCATCAGATATTGTTGATCTGCCGGGCTTGTTCTTCCTCAGTATTCCTAGTGAGGCTCGTCTGCCCACTGGTATTGGTCGCATGACATCTCTTTGCACTCTGGGCATAATTGACCTCAGCAATAACTCAACAGAAAATATTATGTGCCTTGGTGAGCTGACCAATCTCCAGGATCTTCGTCTCACATGTTCCACATTACAGGCTGATAACCTGGAAAAGAATTTGGAATGCTTGGGCTTGATAATTCGGAAACTAAGCAATCTCAAATGTGTAACTCTGGTACCTGTAGTCTCCTCTCATGTAAAAACTCAGGATGATGCCAGTTCTTCAAGGATGACCATTTCTTGGGACGGCTTCACTACCGTGTCTCTTTCTCCAGCCCTTCTTCAGAGACTAGAGTTGTCGCGGCGCTGCTTCATCTTGTCCAGCTTACCTGAGTGGACCAAGGATCTTACGAATCTTGGAATTTTAAAGATGGCTGTTAGCAAGGTGTCAAGCGAAGATGTTGTTATTCTCAAAGGATTGCCTTCCCTCACCGCTCTCTCACTGTTCGTATGGACCGCACCCACAAGAAGGATCATCTTTGACAATGAGGGATTCTTGGTTCTCAAGTACTTCAAGTTTGTGTGTGTTGCGCCATGCCTGTCTTTTTTGGATGGAGCAATGCCCAAAGTCCATAATCTCAAGCTAGGTTTTAATGCTAACAGAATGGAGCAATACAGCCTGGTAGCTGCTGGGTTTGAGCACCTGATTGGCCTAAAAAAGATCTCCATAAAAATTGGGGGAGCCGGTGCTGATGAATGTGATAGAAGGTCTGCACAGTTGGTGTTGACTGATGCCATTAGCAAGCATCCAAACACCTCCATCATCAGTGTACAATGGGTCAACTCGAAATTTTGTGGTGAACAAGATGTGAACGCAGGGGAATCGAGCTCGTACCAGCAGGATACAGGTAATCTTCTCTTTCCCTCTCATTTGACTCTTTGTCCCTTCAACTCAGTTTGTTGCTAA


Protein sequences

Name Description Sequence
RGH2B RGH2B [Hordeum vulgare subsp. vulgare].

MYGVWFASGRNMEMMEAPVSASQGAMRSLPRKLESLLSGPNQGLRPEEKKKLRFLQADLQGLIDSYLFEPSEVESPASTASFWMKDVRDLSYDIDDFIYELGHVAVSGARIGAAQIQKVPGVKISRFPDKLKRRQWISDEISGFRTRVKEAIQRHKTYLGGCRWRPSSSSSQHSAPSPCGRAAIRLVGMDSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLARQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQASSTWDIINHALPKENCCSRILTTTEVDAIAQTCCADTSKYIFKKESLSEDESRELFLGTVFGHEAGCPQVLKEVSNEIIKRSGGLPLAIIILASLLVGQPASSIEHWNHIKNSLSSDSSTNTSLEGIKQVLNLGYEYLPHYLKACMLYLCMYEEDCIIWKDDLVKQWIAEGFIHAMDGNGGKEVARSYFDELVNRGMIQPMDINCNDEILSFSVHTMVLHFIRYKSVEENFSIALDHSQTTIRLADKVRRLALHFGNVEHATPPMPASMRLSQVRSLAFSGLLKCMPSFVEFRFIQVLILKLWADPDNRSDNFIGSDDLSGNITEPDDLSDNLTEHDDLSLNLSEISELFRLRYFHLDACHMSVELPTQMKRLKDLVACEIDANVTAVPSDIVDLPGLFFLSIPSEARLPTGIGRMTSLCTLGIIDLSNNSTENIMCLGELTNLQDLRLTCSTLQADNLEKNLECLGLIIRKLSNLKCVTLVPVVSSHVKTQDDASSSRMTISWDGFTTVSLSPALLQRLELSRRCFILSSLPEWTKDLTNLGILKMAVSKVSSEDVVILKGLPSLTALSLFVWTAPTRRIIFDNEGFLVLKYFKFVCVAPCLSFLDGAMPKVHNLKLGFNANRMEQYSLVAAGFEHLIGLKKISIKIGGAGADECDRRSAQLVLTDAISKHPNTSIISVQWVNSKFCGEQDVNAGESSSYQQDTGNLLFPSHLTLCPFNSVCC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF196
23-895 PTHR23155:SF196,OS11G0225300 PROTEIN

QGAMRSLPRKLESLLSGPNQGLRPEEKKKLRFLQADLQGLIDSYLFEPSEVESPASTASFWMKDVRDLSYDIDDFIYELGHVAVSGARIGAAQIQKVPGVKISRFPDKLKRRQWISDEISGFRTRVKEAIQRHKTYLGGCRWRPSSSSSQHSAPSPCGRAAIRLVGMDSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLARQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQASSTWDIINHALPKENCCSRILTTTEVDAIAQTCCADTSKYIFKKESLSEDESRELFLGTVFGHEAGCPQVLKEVSNEIIKRSGGLPLAIIILASLLVGQPASSIEHWNHIKNSLSSDSSTNTSLEGIKQVLNLGYEYLPHYLKACMLYLCMYEEDCIIWKDDLVKQWIAEGFIHAMDGNGGKEVARSYFDELVNRGMIQPMDINCNDEILSFSVHTMVLHFIRYKSVEENFSIALDHSQTTIRLADKVRRLALHFGNVEHATPPMPASMRLSQVRSLAFSGLLKCMPSFVEFRFIQVLILKLWADPDNRSDNFIGSDDLSGNITEPDDLSDNLTEHDDLSLNLSEISELFRLRYFHLDACHMSVELPTQMKRLKDLVACEIDANVTAVPSDIVDLPGLFFLSIPSEARLPTGIGRMTSLCTLGIIDLSNNSTENIMCLGELTNLQDLRLTCSTLQADNLEKNLECLGLIIRKLSNLKCVTLVPVVSSHVKTQDDASSSRMTISWDGFTTVSLSPALLQRLELSRRCFILSSLPEWTKDLTNLGILKMAVSKVSSEDVVILKGLPSLTALSLFVWTAPTRRIIFDNEGFLVLKYFKFVC

HMMPanther: PTHR23155
23-895 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QGAMRSLPRKLESLLSGPNQGLRPEEKKKLRFLQADLQGLIDSYLFEPSEVESPASTASFWMKDVRDLSYDIDDFIYELGHVAVSGARIGAAQIQKVPGVKISRFPDKLKRRQWISDEISGFRTRVKEAIQRHKTYLGGCRWRPSSSSSQHSAPSPCGRAAIRLVGMDSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLARQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQASSTWDIINHALPKENCCSRILTTTEVDAIAQTCCADTSKYIFKKESLSEDESRELFLGTVFGHEAGCPQVLKEVSNEIIKRSGGLPLAIIILASLLVGQPASSIEHWNHIKNSLSSDSSTNTSLEGIKQVLNLGYEYLPHYLKACMLYLCMYEEDCIIWKDDLVKQWIAEGFIHAMDGNGGKEVARSYFDELVNRGMIQPMDINCNDEILSFSVHTMVLHFIRYKSVEENFSIALDHSQTTIRLADKVRRLALHFGNVEHATPPMPASMRLSQVRSLAFSGLLKCMPSFVEFRFIQVLILKLWADPDNRSDNFIGSDDLSGNITEPDDLSDNLTEHDDLSLNLSEISELFRLRYFHLDACHMSVELPTQMKRLKDLVACEIDANVTAVPSDIVDLPGLFFLSIPSEARLPTGIGRMTSLCTLGIIDLSNNSTENIMCLGELTNLQDLRLTCSTLQADNLEKNLECLGLIIRKLSNLKCVTLVPVVSSHVKTQDDASSSRMTISWDGFTTVSLSPALLQRLELSRRCFILSSLPEWTKDLTNLGILKMAVSKVSSEDVVILKGLPSLTALSLFVWTAPTRRIIFDNEGFLVLKYFKFVC

superfamily: SSF52540
185-419 SSF52540

RLVGMDSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLARQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQASSTWDIINHALPKENCCSRILTTTEVDAIAQTCCADTSKYIFKKESLSEDESRELFLGTVFGHEAGCPQVLKEVSNEIIKRSGGLPLAIIILASLLVGQPASSIEHWNHIKNSLSSDSSTNT

Gene3D: G3DSA:3.40.50.300
186-225 G3DSA:3.40.50.300

LVGMDSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLA

HMMPfam: PF00931
IPR002182
190-474 NB-ARC,NBS
NB-ARC

DSPVEQLCGWLANDGQPEHKVASIVGTSGVGKTTLARQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQASSTWDIINHALPKENCCSRILTTTEVDAIAQTCCADTSKYIFKKESLSEDESRELFLGTVFGHEAGCPQVLKEVSNEIIKRSGGLPLAIIILASLLVGQPASSIEHWNHIKNSLSSDSSTNTSLEGIKQVLNLGYEYLPHYLKACMLYLCMYEEDCIIWKDDLVKQWIAEGFIHAMD

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

VASIVGTSGVGKTTLA

Gene3D: G3DSA:3.40.50.300
226-296 G3DSA:3.40.50.300

RQVYHKLGGQFECRAFVQASPKQDMKMLLTSILSQVRRHHLPDSFDVHKLLFEIEAHLQDKTYIIVIDNLQ

FPrintScan: PR00364
IPR000767
282-296 DISEASERSIST
Disease resistance protein

HLQDKTYIIVIDNLQ

FPrintScan: PR00364
IPR000767
379-393 DISEASERSIST
Disease resistance protein

SGGLPLAIIILASLL

superfamily: SSF52047
543-869 SSF52047,LRR

DKVRRLALHFGNVEHATPPMPASMRLSQVRSLAFSGLLKCMPSFVEFRFIQVLILKLWADPDNRSDNFIGSDDLSGNITEPDDLSDNLTEHDDLSLNLSEISELFRLRYFHLDACHMSVELPTQMKRLKDLVACEIDANVTAVPSDIVDLPGLFFLSIPSEARLPTGIGRMTSLCTLGIIDLSNNSTENIMCLGELTNLQDLRLTCSTLQADNLEKNLECLGLIIRKLSNLKCVTLVPVVSSHVKTQDDASSSRMTISWDGFTTVSLSPALLQRLELSRRCFILSSLPEWTKDLTNLGILKMAVSKVSSEDVVILKGLPSLTALSLF

Gene3D: G3DSA:3.80.10.10
645-681 G3DSA:3.80.10.10

ELFRLRYFHLDACHMSVELPTQMKRLKDLVACEIDAN

Gene3D: G3DSA:3.80.10.10
713-868 G3DSA:3.80.10.10

MTSLCTLGIIDLSNNSTENIMCLGELTNLQDLRLTCSTLQADNLEKNLECLGLIIRKLSNLKCVTLVPVVSSHVKTQDDASSSRMTISWDGFTTVSLSPALLQRLELSRRCFILSSLPEWTKDLTNLGILKMAVSKVSSEDVVILKGLPSLTALSL

FPrintScan: PR00364
IPR000767
714-730 DISEASERSIST
Disease resistance protein

TSLCTLGIIDLSNNSTE


List of References

Fusheng Wei, Rod A Wing, Roger P Wise
Genome dynamics and evolution of the Mla (powdery mildew) resistance locus in barley.
Plant Cell: 2002, 14(8);1903-17
PubMed:12172030 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox