PRGDB00063265 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297823584 (XM_002879629)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata hypothetical protein, mRNA.

DNA Sequence

ATGAGCCTTCAATGTTCCACTCCCATTCGTCGGAGTGGAACACTCAAGGCTCATTTTGATAAAGAGCTAGTGAGAGGTCCAACCCAAGAAAAGGAGCGAAGCATCAGCAATGATGAAGTGTTCGTCAGTGATGTCGTGACCAATGTCAAGAAACTATTTGCATTTAGGGAGACGTCTCTAATGCATCGACAGGAGACAGAAGCAGCAACAACAGTAGTCGATTCCCTTGATGATGACTTATTCTACTCCCATACTTCCTTCTTACAAGCTCTAAACCTTGAAACTACAGACCTTGAAGGATTCACAAAGATTCCGAAGGGTCTCGTTTCTCTGAGGCTGAAAGGGCACACTGATCTAGTGTTCCTCAACTTTAGTTCTACTGAAAATCTGGTCCGATTTCAAAGTTCTGGCTCATTCAAATTCCTTGAAAAGGAGTTTGCTTTCAGTCCTTCAGGTGTCATCAGAATTGAAATTGATAGATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_345479 [Arabidopsis lyrata subsp. lyrata].

MSLQCSTPIRRSGTLKAHFDKELVRGPTQEKERSISNDEVFVSDVVTNVKKLFAFRETSLMHRQETEAATTVVDSLDDDLFYSHTSFLQALNLETTDLEGFTKIPKGLVSLRLKGHTDLVFLNFSSTENLVRFQSSGSFKFLEKEFAFSPSGVIRIEIDR







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox