PRGDB00063266 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297822558 (XM_002879116)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata hypothetical protein, mRNA.

DNA Sequence

ATGGTTGAGGAAAGGCCTCTACCTCGGACGCTTGTTGCTCAGAAGATAATGATGGAAAGTGCAAGGAAAACCCTCATGGATGATGAAACATGGATTATGGGTATGTATGATATGGGAGGAGTGGGAAAAACAGCTCTTCTCGCACAAATCTATGATAAGTTATATGAAGAAAGGCAGATCTTTGACCTTGTGATTTGGGTTGACGTGTCTAGAGATGTACATATAGAAAAGATTCAAGAAGACATTGCTGAAAAACTAGCTATTTATACACACTTTCTTAAGGAAAAGGAGATTCTTGTTATTATTGGACGACGTGTGGAAGAAAGTGGATATAACAGAGATAGGATAGTATTTACCACTCGGTCTAGAGAAATATGTGGACACATGGGAGTTTATGATCCTATGGAAGTTCAGTATCTGGCAGAGAATGATGCATGGGAATTGTTTCAACGAAAAGTCGGACAAAAAACATTATTGAGTCATCCAGACATTTCTATGCTAGCAAGAAAAATTGCTAAAAAATGTCATGGCCTACCGTTAGCACTCAATGTCATTGGTGAGACCATGTCATGTAAAACCTCTGTATATGAATGGAAACACGCAATCGACAGAATTTTCAAGAATGGAAGAGTATATTCTCCCTGTTCTTTGTTGTATAGCTACGACATTTTGAAAGGAGAACATGTTAAGTCGTGCTTCCAATATTGTGTTCTATTTCCTGAAGATCACAAAATACGTAAAGAAGAATTGATAGAGTATTGGATATGCGAGGGTTTTGTTGATGGGAAAGATGGTAGAGAAAGAGCTCTAAACCAAGGTTATGAGATACTTGGTACCCTTTTACGTGCAGGTTTATTGTTGGAGGATGCAAAGACTAAATCATATGTGAAAATGCATGATGTGGTCCGTGAAATGGCTATCTTGGAAATCACAAGGAGAGATGTATTGTACAAGGTGGAGCTAAGTTACGCAAATATGTCGTTGATGCGTACTAACATCAAAATGATATCTGGCAACCCCGATTGTCCTCAACTTACAACTCTCCTTCTCAAAACAAACTACAAGTTGGAAAATATTTCAGGTGAATTTTTTATGTCTATGCCAATGCTAGTAGTCTTGGATCTGTCAATGAACTACCGCCTCGAAGAATTGCCAGAAGAAATATCAGAGTTGGTCTCCTTGCAGTTTCTTGACTTGTCATACACAAGTATAGATCGACTGTCAGTTGGAATACAAAAGTTGAAAAAACTATTACATCTAAATATGGAATCCATGTGGAGACTTGAGAGTATTTACGGGATATCGAATTTGTCGAGTTTGAGATTATTGAAACTACGAAATTCCACGGTATTGGTAGATAACAGCTTAATAGAGGAGCTGCAACTCTTGGAATATCTAGAAACTCTTACCCTAACAATACCATCAAGTTTGGGTTTGAAGAAACTGTTCTCTGCTCACAAGTTGGTGAAATGCATTCAAAAGGTATCTATAAAGAACCTTGAGGAAAAAACATTCAAGATATTATCTTTTCCAGTCATGGATAATCTGAATAGTCTCGCCATATGGAAGTGTGACATGTTGGAGATAAAGATAGAGAAGTCACCATCATGGAACAAAAGTCCAACAAGTTCATGCTTCTCTAACCTCTCATATATATGGATACGAGAGTGTTCGGGTCTAAGGGATTTGACGTGGTTGTTGTTTGCACCAAACCTTATTGATCTGACGGTTGGTTCGATAAATGAACTAGAGGATATAATAAGCAAAGAGAAAGCTGATCAAGCTAGAGAAGAGCAAGGTAATATTATTCCTTTTCAAAAACTGGAATCTCTCTCCTTGATTGATTTACCTACGTTAAAAAGCATCTACTGGAGTCCTCTACCTTTTCCATCTCTTAAGAGAATCAAAGTACAAAAGTGTCGAAAACTTAGAAGGCTTCCATTCGACTCTAAAAGTGGTGTTGTAGGTGAAGATCTTGTCATAAATTACGGAGAGGAGGAATGGATAGAAAGAGTTAAATGGGAAGACGAAGCCACAAGACTTCGTTTCTTATCTTCTTCCTACAAAACCCATAAAGAAATGACTAAACTATCTAGCTCTGCGGGAACTTGTGGGATAAAAGATTTCTAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_320641 [Arabidopsis lyrata subsp. lyrata].

MVEERPLPRTLVAQKIMMESARKTLMDDETWIMGMYDMGGVGKTALLAQIYDKLYEERQIFDLVIWVDVSRDVHIEKIQEDIAEKLAIYTHFLKEKEILVIIGRRVEESGYNRDRIVFTTRSREICGHMGVYDPMEVQYLAENDAWELFQRKVGQKTLLSHPDISMLARKIAKKCHGLPLALNVIGETMSCKTSVYEWKHAIDRIFKNGRVYSPCSLLYSYDILKGEHVKSCFQYCVLFPEDHKIRKEELIEYWICEGFVDGKDGRERALNQGYEILGTLLRAGLLLEDAKTKSYVKMHDVVREMAILEITRRDVLYKVELSYANMSLMRTNIKMISGNPDCPQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSIDRLSVGIQKLKKLLHLNMESMWRLESIYGISNLSSLRLLKLRNSTVLVDNSLIEELQLLEYLETLTLTIPSSLGLKKLFSAHKLVKCIQKVSIKNLEEKTFKILSFPVMDNLNSLAIWKCDMLEIKIEKSPSWNKSPTSSCFSNLSYIWIRECSGLRDLTWLLFAPNLIDLTVGSINELEDIISKEKADQAREEQGNIIPFQKLESLSLIDLPTLKSIYWSPLPFPSLKRIKVQKCRKLRRLPFDSKSGVVGEDLVINYGEEEWIERVKWEDEATRLRFLSSSYKTHKEMTKLSSSAGTCGIKDF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
2-709 PTHR23155:SF108,SUBFAMILY NOT NAMED

VEERPLPRTLVAQKIMMESARKTLMDDETWIMGMYDMGGVGKTALLAQIYDKLYEERQIFDLVIWVDVSRDVHIEKIQEDIAEKLAIYTHFLKEKEILVIIGRRVEESGYNRDRIVFTTRSREICGHMGVYDPMEVQYLAENDAWELFQRKVGQKTLLSHPDISMLARKIAKKCHGLPLALNVIGETMSCKTSVYEWKHAIDRIFKNGRVYSPCSLLYSYDILKGEHVKSCFQYCVLFPEDHKIRKEELIEYWICEGFVDGKDGRERALNQGYEILGTLLRAGLLLEDAKTKSYVKMHDVVREMAILEITRRDVLYKVELSYANMSLMRTNIKMISGNPDCPQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSIDRLSVGIQKLKKLLHLNMESMWRLESIYGISNLSSLRLLKLRNSTVLVDNSLIEELQLLEYLETLTLTIPSSLGLKKLFSAHKLVKCIQKVSIKNLEEKTFKILSFPVMDNLNSLAIWKCDMLEIKIEKSPSWNKSPTSSCFSNLSYIWIRECSGLRDLTWLLFAPNLIDLTVGSINELEDIISKEKADQAREEQGNIIPFQKLESLSLIDLPTLKSIYWSPLPFPSLKRIKVQKCRKLRRLPFDSKSGVVGEDLVINYGEEEWIERVKWEDEATRLRFLSSSYKTHKEMTKLSSSAGTCGIKDF

HMMPanther: PTHR23155
2-709 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEERPLPRTLVAQKIMMESARKTLMDDETWIMGMYDMGGVGKTALLAQIYDKLYEERQIFDLVIWVDVSRDVHIEKIQEDIAEKLAIYTHFLKEKEILVIIGRRVEESGYNRDRIVFTTRSREICGHMGVYDPMEVQYLAENDAWELFQRKVGQKTLLSHPDISMLARKIAKKCHGLPLALNVIGETMSCKTSVYEWKHAIDRIFKNGRVYSPCSLLYSYDILKGEHVKSCFQYCVLFPEDHKIRKEELIEYWICEGFVDGKDGRERALNQGYEILGTLLRAGLLLEDAKTKSYVKMHDVVREMAILEITRRDVLYKVELSYANMSLMRTNIKMISGNPDCPQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSIDRLSVGIQKLKKLLHLNMESMWRLESIYGISNLSSLRLLKLRNSTVLVDNSLIEELQLLEYLETLTLTIPSSLGLKKLFSAHKLVKCIQKVSIKNLEEKTFKILSFPVMDNLNSLAIWKCDMLEIKIEKSPSWNKSPTSSCFSNLSYIWIRECSGLRDLTWLLFAPNLIDLTVGSINELEDIISKEKADQAREEQGNIIPFQKLESLSLIDLPTLKSIYWSPLPFPSLKRIKVQKCRKLRRLPFDSKSGVVGEDLVINYGEEEWIERVKWEDEATRLRFLSSSYKTHKEMTKLSSSAGTCGIKDF

superfamily: SSF52540
3-207 SSF52540

EERPLPRTLVAQKIMMESARKTLMDDETWIMGMYDMGGVGKTALLAQIYDKLYEERQIFDLVIWVDVSRDVHIEKIQEDIAEKLAIYTHFLKEKEILVIIGRRVEESGYNRDRIVFTTRSREICGHMGVYDPMEVQYLAENDAWELFQRKVGQKTLLSHPDISMLARKIAKKCHGLPLALNVIGETMSCKTSVYEWKHAIDRIFK

HMMPfam: PF00931
IPR002182
17-90 NB-ARC,NBS
NB-ARC

MMESARKTLMDDETWIMGMYDMGGVGKTALLAQIYDKLYEERQIFDLVIWVDVSRDVHIEKIQEDIAEKLAIYT

FPrintScan: PR00364
IPR000767
32-47 DISEASERSIST
Disease resistance protein

IMGMYDMGGVGKTALL

HMMPfam: PF00931
IPR002182
109-263 NB-ARC,NBS
NB-ARC

SGYNRDRIVFTTRSREICGHMGVYDPMEVQYLAENDAWELFQRKVGQKTLLSHPDISMLARKIAKKCHGLPLALNVIGETMSCKTSVYEWKHAIDRIFKNGRVYSPCSLLYSYDILKGEHVKSCFQYCVLFPEDHKIRKEELIEYWICEGFVDGK

FPrintScan: PR00364
IPR000767
175-189 DISEASERSIST
Disease resistance protein

CHGLPLALNVIGETM

superfamily: SSF52058
297-660 SSF52058,LRR

KMHDVVREMAILEITRRDVLYKVELSYANMSLMRTNIKMISGNPDCPQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSIDRLSVGIQKLKKLLHLNMESMWRLESIYGISNLSSLRLLKLRNSTVLVDNSLIEELQLLEYLETLTLTIPSSLGLKKLFSAHKLVKCIQKVSIKNLEEKTFKILSFPVMDNLNSLAIWKCDMLEIKIEKSPSWNKSPTSSCFSNLSYIWIRECSGLRDLTWLLFAPNLIDLTVGSINELEDIISKEKADQAREEQGNIIPFQKLESLSLIDLPTLKSIYWSPLPFPSLKRIKVQKCRKLRRLPFDSKSGVVGEDLV

Gene3D: G3DSA:3.80.10.10
327-466 G3DSA:3.80.10.10

SLMRTNIKMISGNPDCPQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSIDRLSVGIQKLKKLLHLNMESMWRLESIYGISNLSSLRLLKLRNSTVLVDNSLIEELQLLEYL

HMMPfam: PF13855
343-404 LRR_8,Leucine rich repeat

PQLTTLLLKTNYKLENISGEFFMSMPMLVVLDLSMNYRLEELPEEISELVSLQFLDLSYTSI

FPrintScan: PR00364
IPR000767
365-381 DISEASERSIST
Disease resistance protein

MSMPMLVVLDLSMNYRL

Gene3D: G3DSA:3.80.10.10
467-643 G3DSA:3.80.10.10

ETLTLTIPSSLGLKKLFSAHKLVKCIQKVSIKNLEEKTFKILSFPVMDNLNSLAIWKCDMLEIKIEKSPSWNKSPTSSCFSNLSYIWIRECSGLRDLTWLLFAPNLIDLTVGSINELEDIISKEKADQAREEQGNIIPFQKLESLSLIDLPTLKSIYWSPLPFPSLKRIKVQKCRKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox