PRGDB00063268 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297819253 (XM_002877464)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata hypothetical protein, mRNA.

DNA Sequence

ATGGTCGATGCGATTGCGGGATTTCTTGTGGGAAAGATCGGCAACTATATCATTGAAGAAGCATCAATGTTGATGGCAGTCAAAGACGATCTAGAGGTGCTGAAGACAGAGTTGACGTGCATCCAAGGTTATCTCAAGGATGTTCAAGCACGAGATAGAGAAGACGAGGTCTCAAAAGAGTGGACAAAACTGGTTTTAGATATCGCTTATGACATTGAGGATGTTTTGGACACCTATCACATGAAACTCGAAGAAAGATCACAAAGGCAAGGCTTCAAGAGATGGGCCAACAAATTAGGCAGGAAAATGGATTCGTCTAGCATAGTTGATGATATCAGAACCCTCAAGGGAAGAATCCTAGATGTTACTCGCAAGCGGAAGACTTATGGAATAGGAAACTTGAACGAGCCTCGAGGAGGAGAGAATAATTTAAGTTCATGGGTAAGGGAGCTTCCGCATGCTCGATTTGTTGATCAAGAAGAGCTTATAGTTGGTTTGGAAGATGATGCTAAGATTCTTTTGGAAAAGATTCTTGATTATAAAGAGAACAAGAGATATATCATCTCCATATTCGGCATGGGAGGTCTTGGAAAGACGGCTCTTGCTAGAAAGCTTTCTAACTCTTGTGATGTGAAGAATAATTTTGAATACCGCGCATGGACTTATGTTTCTCAAGAGTATAAAACCAAAGATATGCTTATGGGAATCATAAGTTCTTTGGGAGTAATTTCTGGGGAAGAATTGGAAAAGATCAGGATGTTTGCGGCAGAGGACTTAGAAGTTTACCTTCACAGTCTTCTAGAAGGGAAAAAATATTTGGTGGTGGTAGATGATATATGGGAGATAGAAGCGTGGGAGAGCCTGAAGAGAGCTTTACCAGAGAATCATAGAGGAAGTAGAGTCATCATCACTACGCGTATCAAAGCCGTGGCTGAAGGCATGGACGAGAGAGTCTATGCTCACAACTTAAGGTTTCTGACATTTGAAGAAAGCTGGAAATTGTTTGAAAAGAAAGCATTCAGGAATAGGCAATGGGTCGATGAAGATCTTCAGAAGATTGGGAAAGAAATGATTAAAAAATGTGGTGGCTTACCGCTTGCTATAGTTGTTCTTGGTGGGTTTCTGTCTAGGAAAAGACCAAGAGACTGGAATGAGGCGTGTGGCAATCTCTGGCGACGCCTAAAGGATAATTCCAATCATTTCTCCACTGTATTTGATCTAAGCTTCAAGGAGCTACGACATGAGTTGAAACTGTGCTTTCTTTACCTTAGTATCTTCCCAGAAGACTATGAGATTAACGTAGAGAAGTTGATACGGTTACTTGTGGCAGAAGGGTTTATAGAAGAGGATAAAGAGATGATGGAAGATGTGGCTCGGTATTATATTGAAGAGTTGATAGACAGAAGTCTGGTGAAAGCTGAAAGAATAGAGAGAGGGAAGGTAATTACTTGTAAAGTCCATGATCTTCTGAGAGACGTGGCTATCAAGAAAGCCAAAGAAAGAGAAGTGGTTCACCATCAGATCAATAGATACTTATCTGAGAAACACCGGAACAAGCGGATGCGATCCTTCTTATTCTTTGGAGAATCAGAGGATTTGGTAGGGCGTGATTTCGAAACCATTTACTTAAAACTGAAGCTACTTCGAGTGCTTGATCTCGGAGGGGTTCGGTTTCCTTGTGAAGAAGGGAAGAAGAGTTTACCAGAAGTGATTGGGGATCTGATCCAATTGAGGTACCTTGGAATTGCTGATACTTTTCTCAGCAATTTACCATCTTTTATCTCCAACTTACGGTTTCTACAAACACTAGATGCATCTGGCAATGAATCCATCAGGCAAACAATTGATCTCCGTAACCTCACATCACTGAGACATGTCATAGGAAAATTCGTTGGAGAATTACTACTAGGCGACACCGTTAACCTTCAGACCTTGAGGTCTATCTCCTCCTATAGCTGGAGCAAACTAAACCATGAGGTTTTCATAAATCTTCGGGACTTGGAAATCTTTGATTCCATGTGGGTGGATCAGAGAGGAATTTCTTTGGACTTGGCTTCCTTCTCTAAACGGAAGAATCTTCGTGCCTTGACGCTGAAGGTATCCACCTTCAAGTTATCTTCAGAATCGGAAGAAACAGTTCGGTTCCAAACCCTTGTTGAGCTGACACTGCGTTGCGATATAAGGAGACTTCCCAAGGACATGGATGTGATATTTCCTAGTCTTGAGTCACTTACACTTGTCGGATCATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_905877 [Arabidopsis lyrata subsp. lyrata].

MVDAIAGFLVGKIGNYIIEEASMLMAVKDDLEVLKTELTCIQGYLKDVQARDREDEVSKEWTKLVLDIAYDIEDVLDTYHMKLEERSQRQGFKRWANKLGRKMDSSSIVDDIRTLKGRILDVTRKRKTYGIGNLNEPRGGENNLSSWVRELPHARFVDQEELIVGLEDDAKILLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITTRIKAVAEGMDERVYAHNLRFLTFEESWKLFEKKAFRNRQWVDEDLQKIGKEMIKKCGGLPLAIVVLGGFLSRKRPRDWNEACGNLWRRLKDNSNHFSTVFDLSFKELRHELKLCFLYLSIFPEDYEINVEKLIRLLVAEGFIEEDKEMMEDVARYYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKEREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIQLRYLGIADTFLSNLPSFISNLRFLQTLDASGNESIRQTIDLRNLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGISLDLASFSKRKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVGS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF14
13-747 PTHR11017:SF14

IGNYIIEEASMLMAVKDDLEVLKTELTCIQGYLKDVQARDREDEVSKEWTKLVLDIAYDIEDVLDTYHMKLEERSQRQGFKRWANKLGRKMDSSSIVDDIRTLKGRILDVTRKRKTYGIGNLNEPRGGENNLSSWVRELPHARFVDQEELIVGLEDDAKILLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITTRIKAVAEGMDERVYAHNLRFLTFEESWKLFEKKAFRNRQWVDEDLQKIGKEMIKKCGGLPLAIVVLGGFLSRKRPRDWNEACGNLWRRLKDNSNHFSTVFDLSFKELRHELKLCFLYLSIFPEDYEINVEKLIRLLVAEGFIEEDKEMMEDVARYYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKEREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIQLRYLGIADTFLSNLPSFISNLRFLQTLDASGNESIRQTIDLRNLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGISLDLASFSKRKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLV

HMMPanther: PTHR11017
13-747 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGNYIIEEASMLMAVKDDLEVLKTELTCIQGYLKDVQARDREDEVSKEWTKLVLDIAYDIEDVLDTYHMKLEERSQRQGFKRWANKLGRKMDSSSIVDDIRTLKGRILDVTRKRKTYGIGNLNEPRGGENNLSSWVRELPHARFVDQEELIVGLEDDAKILLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITTRIKAVAEGMDERVYAHNLRFLTFEESWKLFEKKAFRNRQWVDEDLQKIGKEMIKKCGGLPLAIVVLGGFLSRKRPRDWNEACGNLWRRLKDNSNHFSTVFDLSFKELRHELKLCFLYLSIFPEDYEINVEKLIRLLVAEGFIEEDKEMMEDVARYYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKEREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIQLRYLGIADTFLSNLPSFISNLRFLQTLDASGNESIRQTIDLRNLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGISLDLASFSKRKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLV

superfamily: SSF52540
145-397 SSF52540

SSWVRELPHARFVDQEELIVGLEDDAKILLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITTRIKAVAEGMDERVYAHNLRFLTFEESWKLFEKKAFRNRQWVDEDLQKIGKEMIKKCGGLPLAIVVLGGFLSRKRPRDWNEACGNLWRRLKDN

Gene3D: G3DSA:3.40.50.300
164-305 G3DSA:3.40.50.300

VGLEDDAKILLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITT

HMMPfam: PF00931
IPR002182
173-450 NB-ARC,NBS
NB-ARC

LLEKILDYKENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLGVISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRVIITTRIKAVAEGMDERVYAHNLRFLTFEESWKLFEKKAFRNRQWVDEDLQKIGKEMIKKCGGLPLAIVVLGGFLSRKRPRDWNEACGNLWRRLKDNSNHFSTVFDLSFKELRHELKLCFLYLSIFPEDYEINVEKLIRLLVAEGFIEED

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

LLEGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CGGLPLAIVVLGGFL

superfamily: SSF52058
485-746 SSF52058,LRR

KVHDLLRDVAIKKAKEREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIQLRYLGIADTFLSNLPSFISNLRFLQTLDASGNESIRQTIDLRNLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGISLDLASFSKRKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTL

Gene3D: G3DSA:3.80.10.10
519-724 G3DSA:3.80.10.10

KRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIQLRYLGIADTFLSNLPSFISNLRFLQTLDASGNESIRQTIDLRNLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGISLDLASFSKRKNLRALTLKVSTFKLSSESEETVRFQTLVELTLR

FPrintScan: PR00364
IPR000767
595-611 DISEASERSIST
Disease resistance protein

SNLRFLQTLDASGNESI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox