PRGDB00063353 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484802 (NM_001074077)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os11g0227200 (Os11g0227200) mRNA, complete cds.

DNA Sequence

ATGGAGGCTGTAATCCTTGCTGTCTCAAAGATTGGTTCAGTTTTAGTGGAGGAAGCCACCAAAGCTGCTATAGCCAAGCTATCTGAAAAAGTTGCAAATCTGAAGGAACTACCGACAAAGGTTGATGAAATAAAGAAGGAACTGGAGACAATGAACAATGTTATAAAAAAGATGAGTACAACACATCCCATCGATGAGGTTGTCAAGGGTTGGATTGTAGAGGTGCGGGGCCTGGCCCACCATGTTCAGGATGTAATGGACAAATATTCATACCATGCTCTTATGTTGGAAGAAGAAAGTTCCATGAAAAAGGTATTCACTAAAAAGAAATATGTCACAGTTTTCAGTGATATTGCGGAAGAGATTATCCAGATAGAGAAAAAGATTGAAAATGCTGGGAAGCGGAAAGAACGGTGGCTGCAGCAGCCTGACCTTATTCCTAACCCGCTTACTTATATTGAAAGGAAACAGTTCCAAGACTGCCTCCTGGCACAAGATTATCTAGTGGGGATTGAAGGCAACAGGAAGCTGCTGACTGAATGGTTGTACTCCAGTGAGCAAGGTAACACAGTGATAACGGTATCTGGTATGGGTGGATTGGGCAAAACCGCTCTGGTCAATAATGTGTATGAGTATGAGCGGGAGAAGAACAATTTTGATGCTTTTTCTTGGATTGTCGTGTCACAGACATATAATGGGGTTGATCTACTGAGGAAATTACTTAGGAAGATTGGTGTTGTCGAAACGACGCCAACAATTGGGTACCCTGAACAGACAAATTTATCAGATTTGGACCCTCGTGACTTGAAAAATATAATAAAGGAAAGGCTAAAGGATAGAAAATTTCTGGTTGTATTGGATGACGTTTGGAACCGGGAAGCATACACTCTGATAGAGGATGCGTTCCTAAGCTGCCAAACAAGTCGCATAATCATCACAACAAGACAGGACGATGTGGCAACTCTTGCATACCCAACACACCGTCTCAAACTCAAACCATTGGAGCACAATGATGCATTTGATCTCTTCTGCAAAAAGACCTTCTATAACAGCATGCACAGCAAGTGCCCACAGGATCTTGAGAAGTTGGCTCACAATATAGTGGACAGGTGCGAAGGCCTGCCACTTGCAATCGTATCTATTGGTGGCTTGTTTTCTTCAGTGAAACTAGAGAGTTATATTTGGAATGAAATGTACAAGCAACTTGGAGACGAGCTAGTGAACAATGATCATATACGAGCAATTCTAAATCTAAGCTACCGTGACTTACCTGGACATCTTAGAAATTGTTTCTTGTATTGTAGCCTATTCCCTGAAGATCATCTGTTTTCACGAGATACCCTCATCTGGCTGTGGGTTGCAGAAGGCTTTGCAGTGCGAAAACAACATAGCACACCAGAGGAGGTGGCTGACAGATATCTTAGGGAACTAATCCAAAGGAATATGCTGGATGTTGTGGAAAATGATGAGCTAGGCAGGGCTAGTAGCTGTAAGATGCATGATCTTGTGCGCGACCTGGCACTTTCTATAGCAAAAGAGGAGAAATTTGGCTTTTCAAATGATTATGGCACAATGATAGAAATGGAAAGGGATGTTCGCCGTCTGTCATCTTGTGGATGGGAAAACAATGATGTACTAAAACTTAAATTTCCACGTCTGCGAACCCTAGTATCATTGAGAGCAATGTCACCCTCCACTTATATGCTGTCCTCAATTTTGTCAGAATCAAACTATCTTACAGTTCTCGAGCTTCAAGACTCAGAAATCACTGAAGTGCCAGAATCCATAGGGAATTTGTTCAACTTACGTTACATCGGCTTGCGGAGCACCAAGGTCAAGACACTCCCACAATCAGTTGAAAAGCTGTCTAATCTCCACACTTTAGACATCAAGCAAACCAAAATAGAGAAGCTACCAAAAGGAATCGCTAAGGTCAAGAAGCTACGGCACCTGATAGCCGATAGATATGCTGATGAAACACAGTCGACGTTCCAGTATTTCGTAGGAATGCAAGCACCCAAAAATCTGTCCAATATGGAGGAACTACAAACTCTTGAGACCATGCAAGCCAGCAAGGACTTGGCTGAGCAGCTGAGTAAATTGTTGAAATTAAGACGTGTATGGATTGACAACATAAGTTATACTGATTGTGCAAAGCTTTTTGCTACCCTGTCAAACATGCAGCTTCTTTCCAGCTTGCTTATCTCTGCAAGGAATGAAAATGAGGCACTTTGCTTTGAGGAACTCAGGCCAAAGTCCAAAGAACTCCACAAGTTAATTATCAGAGGGCAATGGGCCAAGCAGACACTCGACTACCCAATATTTCGTTATCATGGTACACAACTCAATTATCTAGCATTAAGTTGGTGCTATCTTGGGGAAGATATGCTAGGGATACTCTCTTCACGCTTGGAGAACCTCACTTGTCTAAGACTGAACAATATACATGGTACAAAAACATTGGTTCTTGATGCAAAGGCCTTCCCACGCCTGAAGATGCTTGTGCTGAAGCACATGCCTGATGTCAACCAGATACAAATTATGAATGGTGCACTTCCAGTCATTGAAGGTTTGTATATTGTGTTTCTATCAGGGGTGGAGAGTGTCCCTCCTGGCATTGAAACCCTTCGGACCCTGAAAAAACTCTGGCTGCTCAATCTGCACAAGAACTTCAAAGCTGACTGGATTGAGAGAGAAATGCAACAGAAAATGCAGCATGTTCCAGAGCTACTCATGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0227200 [Oryza sativa Japonica Group].

MEAVILAVSKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF198
9-912 PTHR23155:SF198,OS11G0227200 PROTEIN

SKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

HMMPanther: PTHR23155
9-912 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

superfamily: SSF52540
151-417 SSF52540

TYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILN

Gene3D: G3DSA:3.40.50.300
175-325 G3DSA:3.40.50.300

RKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYP

HMMPfam: PF00931
IPR002182
178-459 NB-ARC,NBS
NB-ARC

LTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAV

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTALV

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

RLKDRKFLVVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CEGLPLAIVSIGGLF

superfamily: SSF52058
482-906 SSF52058,LRR

MLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQH

Gene3D: G3DSA:3.80.10.10
569-653 G3DSA:3.80.10.10

LSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIA

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

EKLSNLHTLDIKQTKIE

Gene3D: G3DSA:3.80.10.10
675-884 G3DSA:3.80.10.10

NLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox