PRGDB00063353 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115484802 (NM_001074077)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os11g0227200 (Os11g0227200) mRNA, complete cds.

DNA Sequence

ATGGAGGCTGTAATCCTTGCTGTCTCAAAGATTGGTTCAGTTTTAGTGGAGGAAGCCACCAAAGCTGCTATAGCCAAGCTATCTGAAAAAGTTGCAAATCTGAAGGAACTACCGACAAAGGTTGATGAAATAAAGAAGGAACTGGAGACAATGAACAATGTTATAAAAAAGATGAGTACAACACATCCCATCGATGAGGTTGTCAAGGGTTGGATTGTAGAGGTGCGGGGCCTGGCCCACCATGTTCAGGATGTAATGGACAAATATTCATACCATGCTCTTATGTTGGAAGAAGAAAGTTCCATGAAAAAGGTATTCACTAAAAAGAAATATGTCACAGTTTTCAGTGATATTGCGGAAGAGATTATCCAGATAGAGAAAAAGATTGAAAATGCTGGGAAGCGGAAAGAACGGTGGCTGCAGCAGCCTGACCTTATTCCTAACCCGCTTACTTATATTGAAAGGAAACAGTTCCAAGACTGCCTCCTGGCACAAGATTATCTAGTGGGGATTGAAGGCAACAGGAAGCTGCTGACTGAATGGTTGTACTCCAGTGAGCAAGGTAACACAGTGATAACGGTATCTGGTATGGGTGGATTGGGCAAAACCGCTCTGGTCAATAATGTGTATGAGTATGAGCGGGAGAAGAACAATTTTGATGCTTTTTCTTGGATTGTCGTGTCACAGACATATAATGGGGTTGATCTACTGAGGAAATTACTTAGGAAGATTGGTGTTGTCGAAACGACGCCAACAATTGGGTACCCTGAACAGACAAATTTATCAGATTTGGACCCTCGTGACTTGAAAAATATAATAAAGGAAAGGCTAAAGGATAGAAAATTTCTGGTTGTATTGGATGACGTTTGGAACCGGGAAGCATACACTCTGATAGAGGATGCGTTCCTAAGCTGCCAAACAAGTCGCATAATCATCACAACAAGACAGGACGATGTGGCAACTCTTGCATACCCAACACACCGTCTCAAACTCAAACCATTGGAGCACAATGATGCATTTGATCTCTTCTGCAAAAAGACCTTCTATAACAGCATGCACAGCAAGTGCCCACAGGATCTTGAGAAGTTGGCTCACAATATAGTGGACAGGTGCGAAGGCCTGCCACTTGCAATCGTATCTATTGGTGGCTTGTTTTCTTCAGTGAAACTAGAGAGTTATATTTGGAATGAAATGTACAAGCAACTTGGAGACGAGCTAGTGAACAATGATCATATACGAGCAATTCTAAATCTAAGCTACCGTGACTTACCTGGACATCTTAGAAATTGTTTCTTGTATTGTAGCCTATTCCCTGAAGATCATCTGTTTTCACGAGATACCCTCATCTGGCTGTGGGTTGCAGAAGGCTTTGCAGTGCGAAAACAACATAGCACACCAGAGGAGGTGGCTGACAGATATCTTAGGGAACTAATCCAAAGGAATATGCTGGATGTTGTGGAAAATGATGAGCTAGGCAGGGCTAGTAGCTGTAAGATGCATGATCTTGTGCGCGACCTGGCACTTTCTATAGCAAAAGAGGAGAAATTTGGCTTTTCAAATGATTATGGCACAATGATAGAAATGGAAAGGGATGTTCGCCGTCTGTCATCTTGTGGATGGGAAAACAATGATGTACTAAAACTTAAATTTCCACGTCTGCGAACCCTAGTATCATTGAGAGCAATGTCACCCTCCACTTATATGCTGTCCTCAATTTTGTCAGAATCAAACTATCTTACAGTTCTCGAGCTTCAAGACTCAGAAATCACTGAAGTGCCAGAATCCATAGGGAATTTGTTCAACTTACGTTACATCGGCTTGCGGAGCACCAAGGTCAAGACACTCCCACAATCAGTTGAAAAGCTGTCTAATCTCCACACTTTAGACATCAAGCAAACCAAAATAGAGAAGCTACCAAAAGGAATCGCTAAGGTCAAGAAGCTACGGCACCTGATAGCCGATAGATATGCTGATGAAACACAGTCGACGTTCCAGTATTTCGTAGGAATGCAAGCACCCAAAAATCTGTCCAATATGGAGGAACTACAAACTCTTGAGACCATGCAAGCCAGCAAGGACTTGGCTGAGCAGCTGAGTAAATTGTTGAAATTAAGACGTGTATGGATTGACAACATAAGTTATACTGATTGTGCAAAGCTTTTTGCTACCCTGTCAAACATGCAGCTTCTTTCCAGCTTGCTTATCTCTGCAAGGAATGAAAATGAGGCACTTTGCTTTGAGGAACTCAGGCCAAAGTCCAAAGAACTCCACAAGTTAATTATCAGAGGGCAATGGGCCAAGCAGACACTCGACTACCCAATATTTCGTTATCATGGTACACAACTCAATTATCTAGCATTAAGTTGGTGCTATCTTGGGGAAGATATGCTAGGGATACTCTCTTCACGCTTGGAGAACCTCACTTGTCTAAGACTGAACAATATACATGGTACAAAAACATTGGTTCTTGATGCAAAGGCCTTCCCACGCCTGAAGATGCTTGTGCTGAAGCACATGCCTGATGTCAACCAGATACAAATTATGAATGGTGCACTTCCAGTCATTGAAGGTTTGTATATTGTGTTTCTATCAGGGGTGGAGAGTGTCCCTCCTGGCATTGAAACCCTTCGGACCCTGAAAAAACTCTGGCTGCTCAATCTGCACAAGAACTTCAAAGCTGACTGGATTGAGAGAGAAATGCAACAGAAAATGCAGCATGTTCCAGAGCTACTCATGTAG


Protein sequences

Name Description Sequence
hypothetical protein Os11g0227200 [Oryza sativa Japonica Group].

MEAVILAVSKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF198
9-912 PTHR23155:SF198,OS11G0227200 PROTEIN

SKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

HMMPanther: PTHR23155
9-912 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SKIGSVLVEEATKAAIAKLSEKVANLKELPTKVDEIKKELETMNNVIKKMSTTHPIDEVVKGWIVEVRGLAHHVQDVMDKYSYHALMLEEESSMKKVFTKKKYVTVFSDIAEEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAVRKQHSTPEEVADRYLRELIQRNMLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQHVPELLM

superfamily: SSF52540
151-417 SSF52540

TYIERKQFQDCLLAQDYLVGIEGNRKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILN

Gene3D: G3DSA:3.40.50.300
175-325 G3DSA:3.40.50.300

RKLLTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYP

HMMPfam: PF00931
IPR002182
178-459 NB-ARC,NBS
NB-ARC

LTEWLYSSEQGNTVITVSGMGGLGKTALVNNVYEYEREKNNFDAFSWIVVSQTYNGVDLLRKLLRKIGVVETTPTIGYPEQTNLSDLDPRDLKNIIKERLKDRKFLVVLDDVWNREAYTLIEDAFLSCQTSRIIITTRQDDVATLAYPTHRLKLKPLEHNDAFDLFCKKTFYNSMHSKCPQDLEKLAHNIVDRCEGLPLAIVSIGGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGHLRNCFLYCSLFPEDHLFSRDTLIWLWVAEGFAV

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTALV

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

RLKDRKFLVVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CEGLPLAIVSIGGLF

superfamily: SSF52058
482-906 SSF52058,LRR

MLDVVENDELGRASSCKMHDLVRDLALSIAKEEKFGFSNDYGTMIEMERDVRRLSSCGWENNDVLKLKFPRLRTLVSLRAMSPSTYMLSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIADRYADETQSTFQYFVGMQAPKNLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWLLNLHKNFKADWIEREMQQKMQH

Gene3D: G3DSA:3.80.10.10
569-653 G3DSA:3.80.10.10

LSSILSESNYLTVLELQDSEITEVPESIGNLFNLRYIGLRSTKVKTLPQSVEKLSNLHTLDIKQTKIEKLPKGIAKVKKLRHLIA

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

EKLSNLHTLDIKQTKIE

Gene3D: G3DSA:3.80.10.10
675-884 G3DSA:3.80.10.10

NLSNMEELQTLETMQASKDLAEQLSKLLKLRRVWIDNISYTDCAKLFATLSNMQLLSSLLISARNENEALCFEELRPKSKELHKLIIRGQWAKQTLDYPIFRYHGTQLNYLALSWCYLGEDMLGILSSRLENLTCLRLNNIHGTKTLVLDAKAFPRLKMLVLKHMPDVNQIQIMNGALPVIEGLYIVFLSGVESVPPGIETLRTLKKLWL


List of References

, Tsuyoshi Tanaka, Baltazar A Antonio, Shoshi Kikuchi, Takashi Matsumoto, Yoshiaki Nagamura, Hisataka Numa, Hiroaki Sakai, Jianzhong Wu, Takeshi Itoh, Takuji Sasaki, Ryo Aono, Yasuyuki Fujii, Takuya Habara, Erimi Harada, Masako Kanno, Yoshihiro Kawahara, Hiroaki Kawashima, Hiromi Kubooka, Akihiro Matsuya, Hajime Nakaoka, Naomi Saichi, Ryoko Sanbonmatsu, Yoshiharu Sato, Yuji Shinso, Mami Suzuki, Jun-ichi Takeda, Motohiko Tanino, Fusano Todokoro, Kaori Yamaguchi, Naoyuki Yamamoto, Chisato Yamasaki, Tadashi Imanishi, Toshihisa Okido, Masahito Tada, Kazuho Ikeo, Yoshio Tateno, Takashi Gojobori, Yao-Cheng Lin, Fu-Jin Wei, Yue-ie Hsing, Qiang Zhao, Bin Han, Melissa R Kramer, Richard W McCombie, David Lonsdale, Claire C O'Donovan, Eleanor J Whitfield, Rolf Apweiler, Kanako O Koyanagi, Jitendra P Khurana, Saurabh Raghuvanshi, Nagendra K Singh, Akhilesh K Tyagi, Georg Haberer, Masaki Fujisawa, Satomi Hosokawa, Yukiyo Ito, Hiroshi Ikawa, Michie Shibata, Mayu Yamamoto, Richard M Bruskiewich, Douglas R Hoen, Thomas E Bureau, Nobukazu Namiki, Hajime Ohyanagi, Yasumichi Sakai, Satoshi Nobushima, Katsumi Sakata, Roberto A Barrero, Yutaka Sato, Alexandre Souvorov, Brian Smith-White, Tatiana Tatusova, Suyoung An, Gynheung An, Satoshi OOta, Galina Fuks, Galina Fuks, Joachim Messing, Karen R Christie, Damien Lieberherr, HyeRan Kim, Andrea Zuccolo, Rod A Wing, Kan Nobuta, Pamela J Green, Cheng Lu, Blake C Meyers, Cristian Chaparro, Benoit Piegu, Olivier Panaud, Manuel Echeverria
The Rice Annotation Project Database (RAP-DB): 2008 update.
Nucleic Acids Res.: 2008, 36(Database issue);D1028-33
PubMed:18089549 WorldCat.org DOI (I p)

, Takeshi Itoh, Tsuyoshi Tanaka, Roberto A Barrero, Chisato Yamasaki, Yasuyuki Fujii, Phillip B Hilton, Baltazar A Antonio, Hideo Aono, Rolf Apweiler, Richard Bruskiewich, Thomas Bureau, Frances Burr, Antonio Costa de Oliveira, Galina Fuks, Takuya Habara, Georg Haberer, Bin Han, Erimi Harada, Aiko T Hiraki, Hirohiko Hirochika, Douglas Hoen, Hiroki Hokari, Satomi Hosokawa, Yue-ie Hsing, Hiroshi Ikawa, Kazuho Ikeo, Tadashi Imanishi, Yukiyo Ito, Pankaj Jaiswal, Masako Kanno, Yoshihiro Kawahara, Toshiyuki Kawamura, Hiroaki Kawashima, Jitendra P Khurana, Shoshi Kikuchi, Setsuko Komatsu, Kanako O Koyanagi, Hiromi Kubooka, Damien Lieberherr, Yao-Cheng Lin, David Lonsdale, Takashi Matsumoto, Akihiro Matsuya, W Richard McCombie, Joachim Messing, Akio Miyao, Nicola Mulder, Yoshiaki Nagamura, Jongmin Nam, Nobukazu Namiki, Hisataka Numa, Shin Nurimoto, Claire O'Donovan, Hajime Ohyanagi, Toshihisa Okido, Satoshi Oota, Naoki Osato, Lance E Palmer, Francis Quetier, Saurabh Raghuvanshi, Naomi Saichi, Hiroaki Sakai, Yasumichi Sakai, Katsumi Sakata, Tetsuya Sakurai, Fumihiko Sato, Yoshiharu Sato, Heiko Schoof, Motoaki Seki, Michie Shibata, Yuji Shimizu, Kazuo Shinozaki, Yuji Shinso, Nagendra K Singh, Brian Smith-White, Jun-ichi Takeda, Motohiko Tanino, Tatiana Tatusova, Supat Thongjuea, Fusano Todokoro, Mika Tsugane, Akhilesh K Tyagi, Apichart Vanavichit, Aihui Wang, Rod A Wing, Kaori Yamaguchi, Mayu Yamamoto, Naoyuki Yamamoto, Yeisoo Yu, Hao Zhang, Qiang Zhao, Kenichi Higo, Benjamin Burr, Takashi Gojobori, Takuji Sasaki
Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.
Genome Res.: 2007, 17(2);175-83
PubMed:17210932 WorldCat.org DOI (P p)

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox