PRGDB00063355 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115476601 (NM_001068432)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os08g0439100 (Os08g0439100) mRNA, complete cds.

DNA Sequence

ATGGCCACGATCACCTTGAAGCCGCCGGCGACGGCGGCGGCGGCGGGAGGGGAGGTGTCCGAGGTGGAGCTCTCGGAGGCGGGATCGCCGGATGTCGGCAGCCAGAGCAGCGGGAGCGGTGGGAGCGGGCGGAGCACGGCGGGGTCCTCCGGGTGGGTGTACCACCTCGGCGTGAACTCCATCGGCCACGAGTACCGCCACCTCCGGTTCCTCGTCATCCGCGGCAAGACGGTGGCCATGTACAAGCGCGACCCGAGCAAGAACCCCGGAATCCAACCTATCCGAAAGGGTGTTGTAAGTCACACTCTTATGGTGGAGGAGCTTGGTCGCCGGATTACTAGCCATGGGGAACTGTATGTCTTGCGGTTTTACAATCGGTTGGATCAAACAAAGAAAGGAGAGATTGCATGTGGGGACCCCGGTGAAGCTAGGAAATGGGTTGAAGCATTTGAGCAGGCAAAACAGCAGGCTGATTATGACCTGATGACGAGAGGGGTTAGTTGGAATAGATCCCAGAATGAAAACGAGCTTAATCTTGATGGGCATCGACCACGTGTAAGGAGATATGCACAAGGCTTGGGGAAACTTGTACGAATTGGTAAAGGGCCAGAAAAGCTCTTGCGGCAGTCTTCAAATCTTCAAAGCCATGAGATAATTAATACAAACTTTGGAGGCGATTCTGGAGATGCATTCGAAGCACACGAATGGAGATATGTTCGAACATTTAATGGTATAAGAATTTTTGAAGATATTGCAAACACAAAGGGTGGAAAAGGGGTACTTCTTAAGTCTGTTGGTGTGGTTGGGGCGAATCCTGATACTGTATTTGCAGTGGTTCTCAGCTCTGATAAGCATAAGCGATATGAGTGGGATATGCTGACTGCCGATTTGGAATTGGTAGAAACAATTGATGGATACTATGACGTGGTTTATGGAACCTATGAACCTAGATATTTAAGCTGGTGGAAAACAAAGAAGGATTTTGTTTTTTCCAGACAATGGTTTCGTGGACAAGATGGGGCATATACCATTTTGCAGATTCCTGCTTGTCACAAGAACAAACCTCCAAGGCATGGCTACGAGCGTACAAAAATCAATTCCTCAACATGGGAACTAAGAAGGTTGAACCCACCAGGATCATCAACTCCGAAATGCCTTGTTACTCATATGTTGGAAATGAGCCCAAGTTTTTGGGATAGATGGAAGAGAAGACATAACGAGAATTTTGACAGAAGTATTGCTTTTGCTTTGCTCAGCCAAGTAGCAGGTCTAAGAGAATACTTTGCAGCAAATCCAGCTTTGACATCTGATTTGCCTTCAACAGTAGTGAAGCCCAAACAGTCTGATTCTTTGATCATCCAGAGTGAACTGGAAGATTCTGAACTTAATGATGAATTCTATGATGCACTTGCTAGAGGCGAATCCTTTGAAGATGAGGATAGTGATGACGATGATGATATGATTCCTAAGGCTGGAAAAGTGAAGTTCAAGAATATTTCATGGGCTATCGCAGGTCTTGCTATGAAACCGACTAAAGCTTCGGTTGAGAAGAGTGAATTGGTTACAAATTCAACTCCGGTAACTATTGATTCAAACCATTTCCATGGCACCCTTCGACGAGCGAAAAGTGAGAATGACCCAAACTCTTGGAGTGAGCCTGGTGGAGAGAAGTTCATGATAAGAGGAAAGACTTACCTGACAGATTACACTAAGGTTGTTGGAGGTGATCCCCTTCTAAAGCTTATTGCTGTCGATTGGTTTAAGGCTGATGAGCGTTTTGATTCAGTTGCCTTACACCCCAAGAGCCTCGTTCAGTCAGAAGCTGCAAAGAAGATTCCCTTCATACTGGTCATAAACTTGCAGGTTCCAGCGAAGCCAAACTATAACTTGGTCATGTACTACGCAGCAGAAAGGCCCGTGAATAAAGATTCTCTGTTGGGAAGATTCATTGATGGAACCGATGCGTTCCGAGATGCCAGATTTAAACTTATACCAAGCATTGTTGAGGGTTATTGGATGGTAAAACGTGCAGTTGGAACAAAAGCTTGTCTTCTGGGAAAAGCAGTAACATGCAATTACCTTCGCCAGGATAACTTTCTAGAGATAGATGTTGACATTGGTTCTTCATCCGTTGCACGGAGCATTATTGGTCTAGTCCTGGGATATGTCACAGGCCTTGTTGTTGATCTTGCTATTCTAATTGAGGCAAAGGAAGAGAAAGAGCTGCCTGAATACATTCTTGGCACAGTTCGCCTAAATCGTGCGAATCCCGACTCTGCAGTACCCATCTAA


Protein sequences

Name Description Sequence
hypothetical protein Os08g0439100 [Oryza sativa Japonica Group].

MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNSIGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYVLRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQADYDLMTRGVSWNRSQNENELNLDGHRPRVRRYAQGLGKLVRIGKGPEKLLRQSSNLQSHEIINTNFGGDSGDAFEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAANPALTSDLPSTVVKPKQSDSLIIQSELEDSELNDEFYDALARGESFEDEDSDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEKSELVTNSTPVTIDSNHFHGTLRRAKSENDPNSWSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHPKSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDARFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRANPDSAVPI


Domains

Domain Start-End Description Sequence

HMMSmart: SM00233
IPR001849
47-157 PH
Pleckstrin homology domain

AGSSGWVYHLGVNSIGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYVLRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQA

superfamily: SSF55961
215-431 SSF55961

SHEIINTNFGGDSGDAFEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAAN

Gene3D: G3DSA:3.30.530.20
IPR023393
231-431 G3DSA:3.30.530.20
START-like domain

FEAHEWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAAN

HMMPanther: PTHR12136
235-376 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

EWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLN

HMMPanther: PTHR12136:SF13
235-376 PTHR12136:SF13,SUBFAMILY NOT NAMED

EWRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLN

ProfileScan: PS50848
IPR002913
236-401 START
Lipid-binding START

WRYVRTFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRW

HMMPfam: PF01852
IPR002913
258-391 START
Lipid-binding START

KGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELVETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGYERTKINSSTWELRRLNPPGSSTPKCLVTHML

HMMPfam: PF07059
IPR009769
550-755 DUF1336
Domain of unknown function DUF1336

WSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHPKSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDARFKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVLGYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRA


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox