PRGDB00063357 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115443640 (NM_001052135)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os02g0102800 (Os02g0102800) mRNA, complete cds.

DNA Sequence

ATGATGCTGAGCTCGTCGGCGTCGAGGCGGGAGGTCGGCGGCGGCGGCGCCGCCTCCAGCACCAAGAGCGGCGAGCTGTCCCTGTCCAAGGTGGCCAGCGTGGCCATACGGGAGTCGTCGGGCTCGGGCTCGGGCGGGATTTCCAAGAGCAGCGAATTGCTGTCGAGGGCAGGAACCATGGCGGCGGCGAGGGAGGCGGCGGCGGCGGCGGTACACCACGAAGGATGGATGGTGCGCTACGGCCGGAGGAAGATCGGCAGGTCCTTCTTCCACACCCGCTACTTCGTCCTCGACAGCAGGCTCCTCGCCTACTACAAGAAGAAACCCAAAGACAACATGGTGCCACTAAAATCGCTGCTGATAGACGGGAATTGCAGGGTGGAGGATAGAGGACTCAAAACACATCATGGACAAATGGTCTATGTCCTGTGCGTTTATAATAAGAAAGAAAAGGAGCATCAGATCACGATGGGCGCGTATGATATTGAGGATGCTCTGGCCTGGAAAAAGAATATAGAACTCATTATCGATCAGCAAGAAAATATGACCTCCAAAAACCGCAAGGCCTTTGCTTCAATGGACTTTGATACGGAACTAGGAGGGCAGTTTATATTCTCAGACCATGACAGCGCAGCTGAAGATGAAGAGGAACGACCTATGTTGATTCGCAGGACAACTATAGGGAATGGTCCCCCTGAATCAATACATGACTGGACCAAAGAGCATGATATCGGTCCACCCAATCAGATTGACCCCATTCAAGTTAGCTCCAAGAAGAATTGGCGCCTACTTAGATGCCAAAATGGACTACGCATCTTTGAAGAACTTCTGGAATTCGATTATCTTGCAAGAAGCTGTAGCAGAGCTATGCGAGCTGTTGGTGTTGTGGAAGCCACATGCGAAGCCATTTTTGGGCTGGTGATGAGCATGGATGTAACAAGATATGAGTGGGACTGCAGCTTTCGCTATGGTAGTTTAGTTGAAGAGGTTGACGGCCACACCGCTATACTGTATCATAAGTTGCAGTTGCACTGGTGCCCAATGTTAGTATGGCCTCGAGACCTATGTTATGTTCGCTATTGGCGGCGTAATGACGATGGAAGTTACGTTGTGCTGTTTCGATCTACAGAGCATCCAAACTGTGGACGTCAAAAAGGATATGTGAGGGCTTTTATTGAAAGTGGAGGTTTCAAGATTTCTCCTCTCAAGTGTCGCAACGGAAGACCCCGCACTCAAGTTCAACACCTAATGCAGATTGATCTCAGGGGATGGCTCCTCAACTACTCTCCTTCCTTTCAGTATCATTCTTTGCTGCAGATACAAAACTGTGTAGCCGGCCTACGAGAATACTTCTCCCAAACAGACGAAACACATATAACTCCAAGGATTCCTGTGATGGAAAACATGGTTGACACATCTGCAGTACAGAAAGATGACAAGAAGAGTACCGAAGAAGTAGACTCCAAGACTAAAACACCAGATCGAGGACAAGCGGACAGTAAAAACATGGGAATCATTGATGAAGAAACAGACGAGGATGAGGACTATCAGGTTCCTGAAGCTAACATAGAGGAAGATCCTAACAAAGATGCTAAGCGTGCAGACGAACCACCAGAAAAGATTGATCTATCATGCTTTTCGGGCATTCTTCGTTGCGATGCGGATGAGAAAAGCCGAAACTGTTGGACAGTACCTGACAGCAAGCTGTTTAAAGTCCGTAGCAAGAACTTCCCGCATGATAAATCAAAGATACCTGCAGCGAGTTACCTGATGGAGCTTGCGGCCATTGACTGGTTTAAGGACAGCAAGCGTATGGATAACGTAGGCAGGCAGAAAGGCTGTGTAGCCCAGGTAGCTGCTGAGAAAGGGATGCATACATTTGTTGCCAACATACAGATCCCTGGATCAACTCATTACAGCTTGGTGATGTACTTCGTGACAAAGTCGCTGAAGAAGGGATCACTGCTGCAGCGATTCTTCGATGGGGATGATGAGTTCCGCAATAGCAGGCTGAAGCTGATACCCTCTGTACCCAAGGGATCATGGATAGTGCGGCAGAGTGTAGGGAGCACGCCGTGCTTGCTGGGGAAGGCGGTGGATTGCAGCTACGTGCGTGGAGCCGGATACCTGGAGGTGGACGTCGACATTGGGTCGTCGGCGGTGGCCAACGGGGTGCTGGGTTTGGTGTTTGGTGTGGTGACGACGCTGGTGGTGGACATGGCGTTCCTAATACAGGCCAACACCTACGAGGAGCTCCCCGAGCAGGTCATCGGCGCCGCCCGTCTCGCTCACGTCGAACCCGCCGCCGCTATCGTCCCCCAGGACCTTACTCCCCCTCCTCCTGCCCTTGCCGACGACGACAACGCCGCTGCTTCTTCCTCCGAGGATGATCATTTGTCCAAGAAAACCAACTAA


Protein sequences

Name Description Sequence
hypothetical protein Os02g0102800 [Oryza sativa Japonica Group].

MMLSSSASRREVGGGGAASSTKSGELSLSKVASVAIRESSGSGSGGISKSSELLSRAGTMAAAREAAAAAVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIGNGPPESIHDWTKEHDIGPPNQIDPIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTDETHITPRIPVMENMVDTSAVQKDDKKSTEEVDSKTKTPDRGQADSKNMGIIDEETDEDEDYQVPEANIEEDPNKDAKRADEPPEKIDLSCFSGILRCDADEKSRNCWTVPDSKLFKVRSKNFPHDKSKIPAASYLMELAAIDWFKDSKRMDNVGRQKGCVAQVAAEKGMHTFVANIQIPGSTHYSLVMYFVTKSLKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVEPAAAIVPQDLTPPPPALADDDNAAASSSEDDHLSKKTN


Domains

Domain Start-End Description Sequence

superfamily: SSF50729
66-185 SSF50729

AAAAAVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSK

ProfileScan: PS50003
IPR001849
70-177 PH_DOMAIN
Pleckstrin homology domain

AVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIID

Gene3D: G3DSA:2.30.29.30
IPR011993
70-185 PH_type
Pleckstrin homology-type

AVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSK

HMMPanther: PTHR12136
71-466 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

VHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIGNGPPESIHDWTKEHDIGPPNQIDPIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTDETHITPRIPVM

HMMPanther: PTHR12136:SF13
71-466 PTHR12136:SF13,SUBFAMILY NOT NAMED

VHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIGNGPPESIHDWTKEHDIGPPNQIDPIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTDETHITPRIPVM

HMMSmart: SM00233
IPR001849
71-179 PH
Pleckstrin homology domain

VHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLLIDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQ

HMMSmart: SM00234
IPR002913
236-453 START
Lipid-binding START

HDWTKEHDIGPPNQIDPIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQ

ProfileScan: PS50848
IPR002913
256-438 START
Lipid-binding START

SSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLL

superfamily: SSF55961
257-456 SSF55961

SKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTDE

Gene3D: G3DSA:3.30.530.20
IPR023393
257-455 G3DSA:3.30.530.20
START-like domain

SKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTD

HMMPfam: PF01852
IPR002913
286-426 START
Lipid-binding START

CSRAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLL

HMMPfam: PF07059
IPR009769
562-766 DUF1336
Domain of unknown function DUF1336

WTVPDSKLFKVRSKNFPHDKSKIPAASYLMELAAIDWFKDSKRMDNVGRQKGCVAQVAAEKGMHTFVANIQIPGSTHYSLVMYFVTKSLKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVE


List of References

, Takeshi Itoh, Tsuyoshi Tanaka, Roberto A Barrero, Chisato Yamasaki, Yasuyuki Fujii, Phillip B Hilton, Baltazar A Antonio, Hideo Aono, Rolf Apweiler, Richard Bruskiewich, Thomas Bureau, Frances Burr, Antonio Costa de Oliveira, Galina Fuks, Takuya Habara, Georg Haberer, Bin Han, Erimi Harada, Aiko T Hiraki, Hirohiko Hirochika, Douglas Hoen, Hiroki Hokari, Satomi Hosokawa, Yue-ie Hsing, Hiroshi Ikawa, Kazuho Ikeo, Tadashi Imanishi, Yukiyo Ito, Pankaj Jaiswal, Masako Kanno, Yoshihiro Kawahara, Toshiyuki Kawamura, Hiroaki Kawashima, Jitendra P Khurana, Shoshi Kikuchi, Setsuko Komatsu, Kanako O Koyanagi, Hiromi Kubooka, Damien Lieberherr, Yao-Cheng Lin, David Lonsdale, Takashi Matsumoto, Akihiro Matsuya, W Richard McCombie, Joachim Messing, Akio Miyao, Nicola Mulder, Yoshiaki Nagamura, Jongmin Nam, Nobukazu Namiki, Hisataka Numa, Shin Nurimoto, Claire O'Donovan, Hajime Ohyanagi, Toshihisa Okido, Satoshi Oota, Naoki Osato, Lance E Palmer, Francis Quetier, Saurabh Raghuvanshi, Naomi Saichi, Hiroaki Sakai, Yasumichi Sakai, Katsumi Sakata, Tetsuya Sakurai, Fumihiko Sato, Yoshiharu Sato, Heiko Schoof, Motoaki Seki, Michie Shibata, Yuji Shimizu, Kazuo Shinozaki, Yuji Shinso, Nagendra K Singh, Brian Smith-White, Jun-ichi Takeda, Motohiko Tanino, Tatiana Tatusova, Supat Thongjuea, Fusano Todokoro, Mika Tsugane, Akhilesh K Tyagi, Apichart Vanavichit, Aihui Wang, Rod A Wing, Kaori Yamaguchi, Mayu Yamamoto, Naoyuki Yamamoto, Yeisoo Yu, Hao Zhang, Qiang Zhao, Kenichi Higo, Benjamin Burr, Takashi Gojobori, Takuji Sasaki
Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.
Genome Res.: 2007, 17(2);175-83
PubMed:17210932 WorldCat.org DOI (P p)

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox