PRGDB00063359 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115436519 (NM_001049553)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group Os01g0359800 (Os01g0359800) mRNA, complete cds.

DNA Sequence

ATGGCTGATCTAGTAACCAGCATGGTGATCGGGCCTTTAGTGTCAATGGTGAAGGAGAAGGCCTCCAGTTACCTGCTGGAGCAGTACAAGGTGATGGAGGGCATGGAGGAGCAGCATGAGATTCTCAAGCGCAAGCTGCCAGCTATCCTCGATGTCATCAGCGATGCTGAGGAGCAGGCATCCCACAGACAAGGAGTAAAAGCCTGGCTTGAGGCACTCAAGAAGGTGGCCTATGAGGCTAATGACATCTTCGATGAGTTCAAGTACGAGGCACTCCGTCGTGAAGCAAAGAAGAATGGGCACTATCGAGGACTCGGCATGGATGCGGTAAAACTCTTTCCTACCCATAACCGTATCATGTTCCGTTATACGATGGGAAAAAAACTTCGTAGGATAGTTCAGATCATTGAGGTCCTTGTGGCAGAAATGAATGCTTTTGGATTCAAATATCAGCGGCAATCATTGGCATCTAAGCAGTGGAGGCAAACAGATTCCATCATTGATTACTCTGAGAAAGATATTGTGGAAAGATCTAGAGAGACAGAGAAGCAAAAGATTGTGAGATCATTACTTGAAAACAATGACATAATGGTTCTTCCAATAGTGGGCATGGGTGGTCTAGGAAAGACAACTTTTGCAAAGCTTATCTATAATGAACCACAAATCAAGGAGCATTTCCAGTTGAATAGATGGGTTTGTGTGTCTGATGAGTTTGATCTTAGTAAAATTGCAAGTAAGATTAGCATGACCACAAATGAGAAAGATTGTGACAATGTGCTTCAGAAGCTCCAGCAAGAAGTTAGTGGAAAGAGGTTTCTCCTAGTGTTGGATGATGTGTGGAATCGTGATGTTGATAAGTGGTCAAAACTAAAGACTTGCCTTCAACAGGGTGCAGCGGGCAGTGTGATATTAACAACAACTCGTCTTGCAGAAGTTGCTCAAATTATGGGAACCGTTCAAGCACACAACCTCACTACGTTGGACAACAGATTTTTATGGGAAATAATTGAAAGAAGAGCTTTCTATTTGAAAAAGGAAAAACCCAGTGAACTTGTTGATATGGTTGACAAATTTGTGGATCGATGCGTTGGCTCTCCTTTAGCTGCAAGAGCTGTAGGCTCTGTACTGAGCAATAAAACCACTCCCAAAGAATGGAATACTTTATTAAGCAAAAGCGTCATCTTTGATGATGATAGTGGGATCTTACCGATTCTCAAACTTAGCTACGATGACTTGCCTTCACAAATGAAGCTATGCTTTGCATTTTGTGCTATATTTCCGAAAGATTATGAGATTGACGTGGAAATGTTGGTAAAGTTATGGATGGCAAATGACTTCATTCCTTCTGAGAATGGAGTTGGCCTTGAAAAAGTTGGCAACCGGATTTTCAACGAACTGGCTCGAAGATCCTTCTTTCAGGATGTGGACGAAACATCACTGTTCAAGATGTACAGGAGGGATAAGCTCTGCCAATTTAGGAAGACGTGCAAGATCCATGATCTCATGCATGACATTGCTTTGTATGTCATGAGAGAAGAATGTGTTACAGTAATGGGTAGGCCTAATTCCATCCAGTTGTTGAAAGATTCTTCTCGCCATCTGTTTTCATCATATCATAGAATGAATACCCTTTTGGATGCTTTTATTGAGAAAAGAATTCTACCTCTCCGGACAGTGATGTTCTTTGGTCACTTAGATGGCTTCCCACAACATTTACTGAAATACAATTCTCTACGAGCATTATGCATACCTAATTTTCGTGGGCGACCATGTCTAATTCAAGCAAAGCATTTGCATCATCTAAGGTATCTCAATCTTTCTCATAGCTGGAATATGGAAAGACTTCCTGAGGAAATAAGCATATTATATAATTTACAAACGTTGGATCTTTCTGATTGCTGTTCTCTTCGTTGTCTTCCAAAAAATATGAAGTATATGACTAGCCTCCGGCACCTATACACTCAAGGATGTACAGACTTGGAGTGCATGCCTCCAGAACTGAGAAAAGTAACTGCACTACAGACACTTACATATTTTGTTGTGGGCAATAGCTCGGATTGTAGTAATGTTGGAGAGATACATGACTTAAATCTTGGAGGTGAGCTGGAGCTTGGCAAACTAGAAAATGCAAATGAAGAACAAGCAATTGCAGCAAATATTAAAGAAAAGGTGGATCTCACACATTTGTGTTTCAAATGGAGCAATGACATAGAAAAGGACCCAGAACATTATCAGAATGTTCTAGGCGCTCTAAGGCCTCATGCTAAGCTACAATTGCTAAAGGTACAGTCGTTCAAAGGAACCAATTTCCCGACATGGATGACAGATGTATGTACATTCATGAACTTGACAGAGATCCATTTAGTTGATTGCCCATTATGCAAGGAAATTCCGAAGTTCTGGAAGCTACCAGCCCTTGAAGTTCTGCATTTAACAGGATTGAATAAATTGCAAAGCCTATGCAGTGGTGCTAGTGATGTCATTATGTGCTCTGCATTTCAAAAACTCAAGAAACTCAAGTTGCAACATTTGAAGAGCTTGAAGAGATGGGGCACAATGGAGGGAAAACTAGGGGATGAGGCAATATTTCCTGTGCTTGAGGATATTCATATTAAGAACTGTCCAGAGTTGACAGTTATCCCTGAAGCACCAAAAATTGGAACATTGAAGCTGGAAGAAAATAAACCACACCTGTCACTGTTAGTTGTTGGTTCTAGATACATGTCTTTGTTGTCCAAAATGGAGTTGTCAATCGATGACATTGAAGCAGCATTAATACCAGATCAAAGCTCTGTAGAAACATTAGATGACAAGGATATATGGAATAGCGAGGCTTCTGTTACAGAAATGAAGTTAGATGGTTGCAATATGTTCTTCCCCACAACACCATCGAAACCAACAGTTGGGCTTTGGAAATGGTGCAAATATCTTCAAAAACTGGAAATCAAATCCTGTGATGTGCTCATCCACTGGCCACAGAGAGAATTCCAAAGCCTAGAGTCATTGAACGAACTAACAGTTGAGTCTTGCAAAAATCTAAAAGGCATTATGCCAGTGGATGGAGAGCCCATTCAAGGAATTGGGCAGCTCCTACCACGTCTGAAATTTCTAGGAATACGCAACTGCCAAGAGTTAACAGAGATATTTAATCTTCCCTGGTCCCTCAAGACTATTGACATATATCGCTGTCCTAGGTTGAAATCGATATATGGTAAACAGGAGGATAGTGAATCGGGAAGTGCACATGCAGAGCAGCTCACCACATTATTGAGCAAAAGGATGCCAGACCCATCATCATCAGCAGCAGCTGCAGCAACGGAGCATCTTCTACCATGCCTAGAACACCTTAACATAGGGCACTGTGATAGCTTCACAAAGGTTCCTGATCTCCCACCATCGCTCCAAATATTGCACATGTATAACTGCCCTAACGTCCGATTTCTATCGGGGAAGCTGGATGCACTCGACTCCTTATATATTAGTGACTGTAAGAACTTGAGGTCCTTGGGACCATGCCTGGGGAACTTGCCGTCCTTGACAAGTCTCAGCATTTACAGATGCAAAAGCTTGGTGTCCTTGCCGGATGGCCCTGGAGCATACTCCTCCCTAGAGACACTTGAAATCAAGTACTGCCCAGCTATGAAGTCACTTCCTGGACGCCTCCAGCAACGTCTTGATAGCCTTGAGGAGAAAGACTTGTCAAACATGCGTTCCAGCGATCCATGGGAAGGTATACATTCTGCTTTCCATTTTTCTTTCTTGCGAGCTGTTGATCCCTTGTGTCCTGGTGGCATGTACAGAAAATCAGGAATACTTCTTAACAAGCTATTTTTTGCCTGCTGTGTTCTACTTAACTAA


Protein sequences

Name Description Sequence
hypothetical protein Os01g0359800 [Oryza sativa Japonica Group].

MADLVTSMVIGPLVSMVKEKASSYLLEQYKVMEGMEEQHEILKRKLPAILDVISDAEEQASHRQGVKAWLEALKKVAYEANDIFDEFKYEALRREAKKNGHYRGLGMDAVKLFPTHNRIMFRYTMGKKLRRIVQIIEVLVAEMNAFGFKYQRQSLASKQWRQTDSIIDYSEKDIVERSRETEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQAHNLTTLDNRFLWEIIERRAFYLKKEKPSELVDMVDKFVDRCVGSPLAARAVGSVLSNKTTPKEWNTLLSKSVIFDDDSGILPILKLSYDDLPSQMKLCFAFCAIFPKDYEIDVEMLVKLWMANDFIPSENGVGLEKVGNRIFNELARRSFFQDVDETSLFKMYRRDKLCQFRKTCKIHDLMHDIALYVMREECVTVMGRPNSIQLLKDSSRHLFSSYHRMNTLLDAFIEKRILPLRTVMFFGHLDGFPQHLLKYNSLRALCIPNFRGRPCLIQAKHLHHLRYLNLSHSWNMERLPEEISILYNLQTLDLSDCCSLRCLPKNMKYMTSLRHLYTQGCTDLECMPPELRKVTALQTLTYFVVGNSSDCSNVGEIHDLNLGGELELGKLENANEEQAIAANIKEKVDLTHLCFKWSNDIEKDPEHYQNVLGALRPHAKLQLLKVQSFKGTNFPTWMTDVCTFMNLTEIHLVDCPLCKEIPKFWKLPALEVLHLTGLNKLQSLCSGASDVIMCSAFQKLKKLKLQHLKSLKRWGTMEGKLGDEAIFPVLEDIHIKNCPELTVIPEAPKIGTLKLEENKPHLSLLVVGSRYMSLLSKMELSIDDIEAALIPDQSSVETLDDKDIWNSEASVTEMKLDGCNMFFPTTPSKPTVGLWKWCKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYRCPRLKSIYGKQEDSESGSAHAEQLTTLLSKRMPDPSSSAAAAATEHLLPCLEHLNIGHCDSFTKVPDLPPSLQILHMYNCPNVRFLSGKLDALDSLYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDGPGAYSSLETLEIKYCPAMKSLPGRLQQRLDSLEEKDLSNMRSSDPWEGIHSAFHFSFLRAVDPLCPGGMYRKSGILLNKLFFACCVLLN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-1255 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TSMVIGPLVSMVKEKASSYLLEQYKVMEGMEEQHEILKRKLPAILDVISDAEEQASHRQGVKAWLEALKKVAYEANDIFDEFKYEALRREAKKNGHYRGLGMDAVKLFPTHNRIMFRYTMGKKLRRIVQIIEVLVAEMNAFGFKYQRQSLASKQWRQTDSIIDYSEKDIVERSRETEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQAHNLTTLDNRFLWEIIERRAFYLKKEKPSELVDMVDKFVDRCVGSPLAARAVGSVLSNKTTPKEWNTLLSKSVIFDDDSGILPILKLSYDDLPSQMKLCFAFCAIFPKDYEIDVEMLVKLWMANDFIPSENGVGLEKVGNRIFNELARRSFFQDVDETSLFKMYRRDKLCQFRKTCKIHDLMHDIALYVMREECVTVMGRPNSIQLLKDSSRHLFSSYHRMNTLLDAFIEKRILPLRTVMFFGHLDGFPQHLLKYNSLRALCIPNFRGRPCLIQAKHLHHLRYLNLSHSWNMERLPEEISILYNLQTLDLSDCCSLRCLPKNMKYMTSLRHLYTQGCTDLECMPPELRKVTALQTLTYFVVGNSSDCSNVGEIHDLNLGGELELGKLENANEEQAIAANIKEKVDLTHLCFKWSNDIEKDPEHYQNVLGALRPHAKLQLLKVQSFKGTNFPTWMTDVCTFMNLTEIHLVDCPLCKEIPKFWKLPALEVLHLTGLNKLQSLCSGASDVIMCSAFQKLKKLKLQHLKSLKRWGTMEGKLGDEAIFPVLEDIHIKNCPELTVIPEAPKIGTLKLEENKPHLSLLVVGSRYMSLLSKMELSIDDIEAALIPDQSSVETLDDKDIWNSEASVTEMKLDGCNMFFPTTPSKPTVGLWKWCKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYRCPRLKSIYGKQEDSESGSAHAEQLTTLLSKRMPDPSSSAAAAATEHLLPCLEHLNIGHCDSFTKVPDLPPSLQILHMYNCPNVRFLSGKLDALDSLYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDGPGAYSSLETLEIKYCPAMKSLPGRLQQRLDSLEEKDLSNMRSSDPWEGIHSAFHFSFLR

HMMPanther: PTHR23155:SF124
6-1255 PTHR23155:SF124,OS01G0359800 PROTEIN (PUTATIVE UNCHARACTERIZED PROTEIN)

TSMVIGPLVSMVKEKASSYLLEQYKVMEGMEEQHEILKRKLPAILDVISDAEEQASHRQGVKAWLEALKKVAYEANDIFDEFKYEALRREAKKNGHYRGLGMDAVKLFPTHNRIMFRYTMGKKLRRIVQIIEVLVAEMNAFGFKYQRQSLASKQWRQTDSIIDYSEKDIVERSRETEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQAHNLTTLDNRFLWEIIERRAFYLKKEKPSELVDMVDKFVDRCVGSPLAARAVGSVLSNKTTPKEWNTLLSKSVIFDDDSGILPILKLSYDDLPSQMKLCFAFCAIFPKDYEIDVEMLVKLWMANDFIPSENGVGLEKVGNRIFNELARRSFFQDVDETSLFKMYRRDKLCQFRKTCKIHDLMHDIALYVMREECVTVMGRPNSIQLLKDSSRHLFSSYHRMNTLLDAFIEKRILPLRTVMFFGHLDGFPQHLLKYNSLRALCIPNFRGRPCLIQAKHLHHLRYLNLSHSWNMERLPEEISILYNLQTLDLSDCCSLRCLPKNMKYMTSLRHLYTQGCTDLECMPPELRKVTALQTLTYFVVGNSSDCSNVGEIHDLNLGGELELGKLENANEEQAIAANIKEKVDLTHLCFKWSNDIEKDPEHYQNVLGALRPHAKLQLLKVQSFKGTNFPTWMTDVCTFMNLTEIHLVDCPLCKEIPKFWKLPALEVLHLTGLNKLQSLCSGASDVIMCSAFQKLKKLKLQHLKSLKRWGTMEGKLGDEAIFPVLEDIHIKNCPELTVIPEAPKIGTLKLEENKPHLSLLVVGSRYMSLLSKMELSIDDIEAALIPDQSSVETLDDKDIWNSEASVTEMKLDGCNMFFPTTPSKPTVGLWKWCKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYRCPRLKSIYGKQEDSESGSAHAEQLTTLLSKRMPDPSSSAAAAATEHLLPCLEHLNIGHCDSFTKVPDLPPSLQILHMYNCPNVRFLSGKLDALDSLYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDGPGAYSSLETLEIKYCPAMKSLPGRLQQRLDSLEEKDLSNMRSSDPWEGIHSAFHFSFLR

superfamily: SSF52540
157-391 SSF52540

SKQWRQTDSIIDYSEKDIVERSRETEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQAHNLTTLDNRFLWEIIERRAFYLKKEKPSELVDMVDKFVDRCVGSPLAARAVGSVLSNKTTPKEWNTLLSK

HMMPfam: PF00931
IPR002182
179-451 NB-ARC,NBS
NB-ARC

RETEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQAHNLTTLDNRFLWEIIERRAFYLKKEKPSELVDMVDKFVDRCVGSPLAARAVGSVLSNKTTPKEWNTLLSKSVIFDDDSGILPILKLSYDDLPSQMKLCFAFCAIFPKDYEIDVEMLVKLWMANDFIPSEN

Gene3D: G3DSA:3.40.50.300
181-320 G3DSA:3.40.50.300

TEKQKIVRSLLENNDIMVLPIVGMGGLGKTTFAKLIYNEPQIKEHFQLNRWVCVSDEFDLSKIASKISMTTNEKDCDNVLQKLQQEVSGKRFLLVLDDVWNRDVDKWSKLKTCLQQGAAGSVILTTTRLAEVAQIMGTVQ

FPrintScan: PR00364
IPR000767
198-213 DISEASERSIST
Disease resistance protein

VLPIVGMGGLGKTTFA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

EVSGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CVGSPLAARAVGSVL

superfamily: SSF52058
481-1062 SSF52058,LRR

FKMYRRDKLCQFRKTCKIHDLMHDIALYVMREECVTVMGRPNSIQLLKDSSRHLFSSYHRMNTLLDAFIEKRILPLRTVMFFGHLDGFPQHLLKYNSLRALCIPNFRGRPCLIQAKHLHHLRYLNLSHSWNMERLPEEISILYNLQTLDLSDCCSLRCLPKNMKYMTSLRHLYTQGCTDLECMPPELRKVTALQTLTYFVVGNSSDCSNVGEIHDLNLGGELELGKLENANEEQAIAANIKEKVDLTHLCFKWSNDIEKDPEHYQNVLGALRPHAKLQLLKVQSFKGTNFPTWMTDVCTFMNLTEIHLVDCPLCKEIPKFWKLPALEVLHLTGLNKLQSLCSGASDVIMCSAFQKLKKLKLQHLKSLKRWGTMEGKLGDEAIFPVLEDIHIKNCPELTVIPEAPKIGTLKLEENKPHLSLLVVGSRYMSLLSKMELSIDDIEAALIPDQSSVETLDDKDIWNSEASVTEMKLDGCNMFFPTTPSKPTVGLWKWCKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYR

Gene3D: G3DSA:3.80.10.10
595-669 G3DSA:3.80.10.10

AKHLHHLRYLNLSHSWNMERLPEEISILYNLQTLDLSDCCSLRCLPKNMKYMTSLRHLYTQGCTDLECMPPELRK

FPrintScan: PR00364
IPR000767
620-636 DISEASERSIST
Disease resistance protein

SILYNLQTLDLSDCCSL

HMMPfam: PF00560
IPR001611
624-642 LRR_1
Leucine-rich repeat

NLQTLDLSDCCSLRCLPKN

Gene3D: G3DSA:3.80.10.10
713-890 G3DSA:3.80.10.10

EQAIAANIKEKVDLTHLCFKWSNDIEKDPEHYQNVLGALRPHAKLQLLKVQSFKGTNFPTWMTDVCTFMNLTEIHLVDCPLCKEIPKFWKLPALEVLHLTGLNKLQSLCSGASDVIMCSAFQKLKKLKLQHLKSLKRWGTMEGKLGDEAIFPVLEDIHIKNCPELTVIPEAPKIGTLK

Gene3D: G3DSA:3.80.10.10
974-1127 G3DSA:3.80.10.10

CKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYRCPRLKSIYGKQEDSESGSAHAEQLTTLLSKRMPDPSSSAAAAATEHLLPCLEHLNIGHCDSFTKV

superfamily: SSF52047
974-1258 SSF52047,LRR

CKYLQKLEIKSCDVLIHWPQREFQSLESLNELTVESCKNLKGIMPVDGEPIQGIGQLLPRLKFLGIRNCQELTEIFNLPWSLKTIDIYRCPRLKSIYGKQEDSESGSAHAEQLTTLLSKRMPDPSSSAAAAATEHLLPCLEHLNIGHCDSFTKVPDLPPSLQILHMYNCPNVRFLSGKLDALDSLYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDGPGAYSSLETLEIKYCPAMKSLPGRLQQRLDSLEEKDLSNMRSSDPWEGIHSAFHFSFLRAVD

HMMPfam: PF13504
1032-1048 LRR_7,Leucine rich repeat

PRLKFLGIRNCQELTEI

Gene3D: G3DSA:3.80.10.10
1128-1237 G3DSA:3.80.10.10

PDLPPSLQILHMYNCPNVRFLSGKLDALDSLYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDGPGAYSSLETLEIKYCPAMKSLPGRLQQRLDSLEEKDLSNMR


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox