PRGDB00063360 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297335169 (GL348713)
Gene Class NL
Domain Type NBS, LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_1, whole genome shotgun sequence.

DNA Sequence

AAAATAAATTTGGCAATATAGTGACCATGCCTACCCTGGTTCGTGAAATGGCCTTGTGGGTAGCATCAAATCTTGGGGAGGAGAAAGAAAACTTCATTGTGAAAGCCGTAGCAAAACTTAATCACACTCCAAATGTCAAGGATTGGAGAGGTGTGAGTAGGATCTCATTGTGGGGTAATCGGATCAAGGGTATAAGTTGCAGTCCAGATTGTCCCAAGCTTACAACCTTATTCCTCCAGTTCAATGGTCTGGGGAAGATCTCAAGTGGACTTTTTATGTTTATGCCTAATCTTGTGGTTTTGGATCTAACGGCAAACATTGGCCTCGAGTTGCCTGAAGAGATTTCGAGACTGGTCTCTTTGCAGTATCTCAACTTATCACATACAAAGATAAAGGAACTTCCTCGGGGTTTAAAAGAGCTAAGGAAACTTATACACCTGAACCTGGAGTTTACTGGATGGCTTAAAGGAATTGCTGGGATATCAAGTTTATCAAATCTGCAAGTTCTAAAACTGTATTGTTCCGTCGAATTAAATATGGAACTGGTGGAGGAGTTACAGCTCCTGAAGCATTTAAAAGTTTTGACCGTCTCCGGGGGTGATGCCTATGTCTGGGAAAGATTTATGAGCATTCCCAGATTGGCAAGTTGCACTCGCAGTGCAACTCTTACGCACTGTGAAGCAGGAGCAGATGGAATATCGATTGCCGCGACCTCAAGTAGGCTTAGCGTCCTCCAGATATATGAGTCAAACATAAAGGAGATAAAGATTGATCAGAAAGACGATGATCACTGCAAGCAATAGCTTCCCTTCACTCTCAATCATTTTCCTACTGTTGAGATGGAAGTAAGATCTTTGGGAGCAGATGAGGCATGGGATTTCTTCTGCGAGAGAATTGGAGACACCTTGGAGAGTCACCCGGACATCCGTGAGCTCGCAAGGATAGTTGTTGAAAGATGCAGAGGCTCACCGCTCGCACTTAGTGTTATTGGCGTGACTATGACAGGCAAGACTTTGGTGCAAGAATGGCGGTATGCAATCGACACTTTGACTTTATCGGCGGCTAAGTTTTCAGCATCGCTGGATTCAAGTGGAAATGTGAAGCAAGAGGAGCTTTTTCAAGAGGTACAAATCAAAATGATAATTTACCAATGGCGCTTTCCATGTCCAAAAAAGATAAAAG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_334861 [Arabidopsis lyrata subsp. lyrata].

MALSMSKKDKSIAGFKWKCEARGAFSRGTNQNDNLPLPFTLNHFPTVEMEVRSLGADEAWDFFCERIGDTLESHPDIRELARIVVERCRGSPLALSVIGVTMTGKTLVQEWRYAIDTLTLSAAKFSENKFGNIVTMPTLVREMALWVASNLGEEKENFIVKAVAKLNHTPNVKDWRGVSRISLWGNRIKGISCSPDCPKLTTLFLQFNGLGKISSGLFMFMPNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEFTGWLKGIAGISSLSNLQVLKLYCSVELNMELVEELQLLKHLKVLTVSGGDAYVWERFMSIPRLASCTRSATLTHCEAGADGISIAATSSRLSVLQIYESNIKEIKIDQKDDDHCKQ

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
48-184 NB-ARC,NBS
NB-ARC

EMEVRSLGADEAWDFFCERIGDTLESHPDIRELARIVVERCRGSPLALSVIGVTMTGKTLVQEWRYAIDTLTLSAAKFSENKFGNIVTMPTLVREMALWVASNLGEEKENFIVKAVAKLNHTPNVKDWRGVSRISLW

superfamily: SSF52058
135-381 SSF52058,LRR

TMPTLVREMALWVASNLGEEKENFIVKAVAKLNHTPNVKDWRGVSRISLWGNRIKGISCSPDCPKLTTLFLQFNGLGKISSGLFMFMPNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEFTGWLKGIAGISSLSNLQVLKLYCSVELNMELVEELQLLKHLKVLTVSGGDAYVWERFMSIPRLASCTRSATLTHCEAGADGISIAATSSRLSVLQIYESNIKEI

Gene3D: G3DSA:3.80.10.10
172-325 G3DSA:3.80.10.10

VKDWRGVSRISLWGNRIKGISCSPDCPKLTTLFLQFNGLGKISSGLFMFMPNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEFTGWLKGIAGISSLSNLQVLKLYCSVELNMELVEELQLLKHLKVLTVSG

HMMPanther: PTHR23155:SF108
180-381 PTHR23155:SF108,SUBFAMILY NOT NAMED

RISLWGNRIKGISCSPDCPKLTTLFLQFNGLGKISSGLFMFMPNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEFTGWLKGIAGISSLSNLQVLKLYCSVELNMELVEELQLLKHLKVLTVSGGDAYVWERFMSIPRLASCTRSATLTHCEAGADGISIAATSSRLSVLQIYESNIKEI

HMMPanther: PTHR23155
180-381 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RISLWGNRIKGISCSPDCPKLTTLFLQFNGLGKISSGLFMFMPNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEFTGWLKGIAGISSLSNLQVLKLYCSVELNMELVEELQLLKHLKVLTVSGGDAYVWERFMSIPRLASCTRSATLTHCEAGADGISIAATSSRLSVLQIYESNIKEI

ProfileScan: PS51450
IPR001611
199-220 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTTLFLQFNGLGKISSGLFMF

HMMPfam: PF13855
222-277 LRR_8,Leucine rich repeat

PNLVVLDLTANIGLELPEEISRLVSLQYLNLSHTKIKELPRGLKELRKLIHLNLEF

ProfileScan: PS51450
IPR001611
223-244 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVLDLTANIGLELPEEISRL

ProfileScan: PS51450
IPR001611
246-268 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQYLNLSHTKIKELPRGLKELR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox