PRGDB00063363 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297335169 (GL348713)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_1, whole genome shotgun sequence.

DNA Sequence

ATGAACTCTTACTCTTTCACTCTCTTCATCTTTGCCGCCATTATCTTTCTCCGGTGTTCAAGTTCGACCAAAGCTGCCACTTGTCACCCTGATGATGAGGCGGGTCTTTTAGCTTTCAAATCGGGTATAACCCAAGATCCTTTGGGCCATCTGAACTCGTGGAAGAAAGGTACTGATTGCTGCTCATGGGTGGCTGTTACTTGCACTAGGGGCAATCGCGTCACTGAACTAAACCTAGACGGATCTAGCGTTCTTGGCGGAATCTTTCTCTCTGGCACTATCTCCCCGTTGTTGACCAAACTTCAACACCTTGAGGTGATTTCCTTAATCTCTTTTCGAAAGATGACTGGCTCTTTTCCTCTGTTTCTTTTTCGATTACCAAAGCTAAGGTACCTTAACATCATGAATAATCATCTCCCCGGTCCACTTCCAGCCAACATCGGCACGCTACACCAGTTGGAAGACCTAATTCTCGAGGGAAACCAGTTCACTGGTCAGATCCCGAGTTCCATATCCAATTTGACTAGGTTATTTCGGCTCAATCTTGGCGGCAACCGCCTCTCTGGCACCATCTCAGATATATTTAAACCCATGACGAACCTCCAACATCTTGATCTCTCCCGCAACGGATTCTCCGGGAAACTTCCTCCATCGTTTTCATCGCTTGCACCGACCCTCAAATATCTCGATCTGAGCCAGAACAATCTCTCGGGAACGATTCCGGACTATTTATCAAGATTCGAGACGCTTTCCACATTGGTTCTCTCCAAGAATCAGTACTCGGGGGTTGTGCCAACGAGTTTCGCTAATTTAACCAGTATTTACTATCTCGATCTCTCCCACAATCTCTTAACCGGTCCATTCCATGCCTTGAAGAGTAGCATCGGCTATCTTGATCTATCGTACAACCAATTTAACCTGAAAACCATTCCGGAATGGGTGACCTCGTCGACGAGTTTGTACTCACTAAAGTTGGCTAAATGCAGTATCAAGATGAACTTAAGCGATTGGAGGCCAGTGAAGACCAAATTGTTCAATAACATCGATCTGTCCGAAAACGAGTTCTCAGGGAGTCCAACATGGTTCCTAAACAAGACGGAGGATCTATTGGAGTTCCAGGCGTCGGGAAACAAACTCCAATTTGACATGGGGAAGTTGAGTTTCGCAAAGTCACTTAGAATCTTGGACCTATCAAGGAACTTGGTATTTGGGAAGGTGCCATGGACAGTGGCTAAACTGAAGAAACTAAATTTGAGTCAAAACCATCTTTGTGGAAAGCTTCCGGTGACAAAGTTCCCAGCTAGCGCGTTTGCGGGTAACGATTGTCTTTGTGGCTCTCCACTTTCTCCTTGTAAAGCTTAG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_890947 [Arabidopsis lyrata subsp. lyrata].

MNSYSFTLFIFAAIIFLRCSSSTKAATCHPDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTCTRGNRVTELNLDGSSVLGGIFLSGTISPLLTKLQHLEVISLISFRKMTGSFPLFLFRLPKLRYLNIMNNHLPGPLPANIGTLHQLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRNGFSGKLPPSFSSLAPTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLLTGPFHALKSSIGYLDLSYNQFNLKTIPEWVTSSTSLYSLKLAKCSIKMNLSDWRPVKTKLFNNIDLSENEFSGSPTWFLNKTEDLLEFQASGNKLQFDMGKLSFAKSLRILDLSRNLVFGKVPWTVAKLKKLNLSQNHLCGKLPVTKFPASAFAGNDCLCGSPLSPCKA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-450 PTHR24420,FAMILY NOT NAMED

MNSYSFTLFIFAAIIFLRCSSSTKAATCHPDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTCTRGNRVTELNLDGSSVLGGIFLSGTISPLLTKLQHLEVISLISFRKMTGSFPLFLFRLPKLRYLNIMNNHLPGPLPANIGTLHQLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRNGFSGKLPPSFSSLAPTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLLTGPFHALKSSIGYLDLSYNQFNLKTIPEWVTSSTSLYSLKLAKCSIKMNLSDWRPVKTKLFNNIDLSENEFSGSPTWFLNKTEDLLEFQASGNKLQFDMGKLSFAKSLRILDLSRNLVFGKVPWTVAKLKKLNLSQNHLCGKLPVTKFPASAFAGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-450 PTHR24420:SF510

MNSYSFTLFIFAAIIFLRCSSSTKAATCHPDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTCTRGNRVTELNLDGSSVLGGIFLSGTISPLLTKLQHLEVISLISFRKMTGSFPLFLFRLPKLRYLNIMNNHLPGPLPANIGTLHQLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRNGFSGKLPPSFSSLAPTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLLTGPFHALKSSIGYLDLSYNQFNLKTIPEWVTSSTSLYSLKLAKCSIKMNLSDWRPVKTKLFNNIDLSENEFSGSPTWFLNKTEDLLEFQASGNKLQFDMGKLSFAKSLRILDLSRNLVFGKVPWTVAKLKKLNLSQNHLCGKLPVTKFPASAFAGNDCLCGSPLSP

superfamily: SSF52058
26-340 SSF52058,LRR

ATCHPDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTCTRGNRVTELNLDGSSVLGGIFLSGTISPLLTKLQHLEVISLISFRKMTGSFPLFLFRLPKLRYLNIMNNHLPGPLPANIGTLHQLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRNGFSGKLPPSFSSLAPTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLLTGPFHALKSSIGYLDLSYNQFNLKTIPEWVTSSTSLYSLKLAKCSIKMNLSDWRPV

Gene3D: G3DSA:3.80.10.10
27-319 G3DSA:3.80.10.10

TCHPDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTCTRGNRVTELNLDGSSVLGGIFLSGTISPLLTKLQHLEVISLISFRKMTGSFPLFLFRLPKLRYLNIMNNHLPGPLPANIGTLHQLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRNGFSGKLPPSFSSLAPTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLLTGPFHALKSSIGYLDLSYNQFNLKTIPEWVTSSTS

HMMPfam: PF08263
IPR013210
30-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKSGITQDPLGHLNSWKKGTDCCSWVAVTC

HMMPfam: PF13855
152-209 LRR_8,Leucine rich repeat

QLEDLILEGNQFTGQIPSSISNLTRLFRLNLGGNRLSGTISDIFKPMTNLQHLDLSRN

HMMPfam: PF13855
224-284 LRR_8,Leucine rich repeat

PTLKYLDLSQNNLSGTIPDYLSRFETLSTLVLSKNQYSGVVPTSFANLTSIYYLDLSHNLL

FPrintScan: PR00019
226-239 LEURICHRPT,Leucine-rich repeat signature

LKYLDLSQNNLSGT

FPrintScan: PR00019
271-284 LEURICHRPT,Leucine-rich repeat signature

LTSIYYLDLSHNLL

superfamily: SSF52058
293-428 SSF52058,LRR

SSIGYLDLSYNQFNLKTIPEWVTSSTSLYSLKLAKCSIKMNLSDWRPVKTKLFNNIDLSENEFSGSPTWFLNKTEDLLEFQASGNKLQFDMGKLSFAKSLRILDLSRNLVFGKVPWTVAKLKKLNLSQNHLCGKLP

Gene3D: G3DSA:3.80.10.10
320-430 G3DSA:3.80.10.10

LYSLKLAKCSIKMNLSDWRPVKTKLFNNIDLSENEFSGSPTWFLNKTEDLLEFQASGNKLQFDMGKLSFAKSLRILDLSRNLVFGKVPWTVAKLKKLNLSQNHLCGKLPVT

HMMPfam: PF00560
IPR001611
412-432 LRR_1
Leucine-rich repeat

KLKKLNLSQNHLCGKLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox