PRGDB00063366 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297332168 (GL348714)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_2, whole genome shotgun sequence.

DNA Sequence

CGTGTTTGGGTGATGGTTAATTTTGTTAAATCATGAATGGGGAATGGTGTGTCTTTCCAATGTTCTTGCGATCAAACGCTGAATCACATCTTTAGATGGTTTTGTGGTAAAGGTTATATTCGAAACCTCAAGAAGAATCTCACAGCCTTGAAGAGGGAAATGGAAGATCTCAAAGCAATAAAAGATGAGGTGCAGAACAGGGTATCGAGAGAGGAGATACGACATCAACAAAGACTTGAAGCTGTCCAGGTATGGCTTACCCGTGTCGATAGCATTGATTTACAAATCAAAGATCTACTTAGTACTTGTCCCGTTCAGCACCAGAAGTTGTGTCTCTGTGGTTTGTGTTCAAAAAATGTATGTTCGAGCTACAGTTTTGGGAAAAGGGTATTCTTGTTGTTGGAAGATGTTAAGAAACTCAACTCAGAGAGTAATTTTGAAGTGGTTACTAAGCCTGCCCCGATATCTGAAGTTGAGAAGAGGTTTACTCAGCCTACTATTGGTCAGGAAAAGATGCTCGAAACAGCATGGAATCGCCTTATGGAAGATGGAGTCGAAATCATGGGTTTGCACGGCATGGGTGGTGTAGGAAAAACTACCCTTTTCCATAAAATCCACAATAAGTTTGCTGAAATACCTGGTAGATTTGACGTTGTGATATGGATTGTGGTGTCGCAAGGTGCAGAGATTTCAAAGCTTCAAGAAGATATTGCAAAAAAGCTACACCTTTGGGACGAGGTGTGGAAGGACAAAACTGAAAGTGTTAACGCCGCTGATATACACAATGTTTTACAGAGGAAGAGATTCGTTTTGATGTTAGATGATATATGGGACAAAGTGGATTTACAAGCCCTCGGAGTTCCAATTCCGACCAGAGAAAATGGATGCAAAGTAGCATTCACCACTCGTTCCCGAGAAGTATGTGGGCGGATGGGGGATCATAAACCAGTGGAAGTTCAATGTTTGGGACCAAAGGAAGCATGGGAATTGTTTAAAAACAAGGTCGGAGACAACACATTAAGAAGAGATCCTGTCATTGTCGAGCTTGCAAGAAAGGTCGCTGAAAAATGTGGTGGGCTGCCACTGGCGCTCAATGTCATTGGTGAGGTGATGGCATCTAAAACTATGGTACAAGAATGGGAGGATGCAATCGATGTTTTGACAACATCCGCCGCAGAGTTTCCTGATGTGAAAAATAAAATTCTTCCAATTCTAAAGTACAGCTACGATAGCTTGGTGGATGAAAATATCAAGACATGTTTCCTATATTGTGCTCTCTTTCCGGAAGATTTTAATATAGGTATGGAAAAGTTGATAGACTACTGGATATGCGAAGGATTCATCGGAGACTACTCTGTTATAAAAAGAGCGAGGAATAAGGGTTATACGATGCTCGGTACCCTTATTCGTGCAAATTTACTGACGGAGGTTGGTAAAACATCGGTTGTGATGCATGACGTGGTTCGCGAAATGGCTCTATGGATTGCATCTGATTTTGGGAAACAGAAGGAGAATTTTGTGGTGCGAGCAGGAGTCGGATTACATGAAATACCAGAAATCAAGGATTGGGGAGCTGTGAGAAGAATGTCATTAATGAAGAATAATATTAAAGAGATAACATGTGGTTCCAAGTGTTCTGAACTTACAACTTTGTTCCTTGAAGAAAATCAATTGAAGAATCTATCAGGTGAATTCATTCGGTGTATGCAAAAGCTAGTTGTTTTGGATTTGTCATTGAATCGCAACTTAAATGAACTTCCAGAGCAGATATCAGAGCTGGCCTCCTTGCAGTATCTTGACTTGTCGAGTACAAGTATAGAGCAACTGCCTGTTGGTTTCCATGAGTTGAAAAATTTAACTCATCTGAATTTGAGTTATACATCAATCTGCAGTGTGGGTGCGATATCAAAGTTGTCGAGTTTAAGAATTTTGAAACTAAGAGGTTCTAATGTTCATGCCGATGTAAGCTTAGTGAAAGAGCTGCAGCTCTTGGAGCATCTACAAGTTCTAACCATAACGATATCTACGGAAATGGGGCTGGAGCAAATATTAGATGATGAAAGGTTGGCGAACTGCATCACTGAACTGGGGATTAGCGATTTTCAACAAAAGGCATTCAATATAGAAAGGTTGGCGAACTGCATCACTGATCTGGAGATTAGCGATTTTCAACAAAAGGCATTCAATATATCATTGCTGACGAGTATGGAGAATCTTCGTTTGCTCATGGTGAAGAATAGTCATGTTACAGAGATTAATACAAATCTGATGTGCATAGAAAACAAGACAGACTCGTCTGATTTACACAATCCGAAAATTCCATGCTTTACCAATCTCTCCACCGTGTATATAACGTCCTGCCATAGCATTAAGGATCTGACTTGGCTTCTGTTTGCTCCAAATCTTGTCTTCCTACGTATTTCAGATTCAAGAGAAGTGGAAGAAATTATAAACAAAGAGAAAGCAACCAATCTTACAGGTATTACACCATTTCAGAAACTAGAATTCTTCAGTGTGGAAAAACTGCCGAAGCTGGAGAGTATCTACTGGAGTCCTCTCCCCTTTCCATTATTGAAGCACATATTTGCATATTGCTGCCCAAAGCTGAGAAAGCTTCCCTTAAATGCTACAAGTGTTCCACTAGTTGATGAATTTAAAATTGAGATGGATTCTCAAGAAACTGAGCTTGAATGGGAGGACGAAGATACCAAAAATCGATTCTTGCCTTCAATCAAACGG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_338250 [Arabidopsis lyrata subsp. lyrata].

MGNGVSFQCSCDQTLNHIFRWFCGKGYIRNLKKNLTALKREMEDLKAIKDEVQNRVSREEIRHQQRLEAVQVWLTRVDSIDLQIKDLLSTCPVQHQKLCLCGLCSKNVCSSYSFGKRVFLLLEDVKKLNSESNFEVVTKPAPISEVEKRFTQPTIGQEKMLETAWNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKVDLQALGVPIPTRENGCKVAFTTRSREVCGRMGDHKPVEVQCLGPKEAWELFKNKVGDNTLRRDPVIVELARKVAEKCGGLPLALNVIGEVMASKTMVQEWEDAIDVLTTSAAEFPDVKNKILPILKYSYDSLVDENIKTCFLYCALFPEDFNIGMEKLIDYWICEGFIGDYSVIKRARNKGYTMLGTLIRANLLTEVGKTSVVMHDVVREMALWIASDFGKQKENFVVRAGVGLHEIPEIKDWGAVRRMSLMKNNIKEITCGSKCSELTTLFLEENQLKNLSGEFIRCMQKLVVLDLSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSICSVGAISKLSSLRILKLRGSNVHADVSLVKELQLLEHLQVLTITISTEMGLEQILDDERLANCITELGISDFQQKAFNIERLANCITDLEISDFQQKAFNISLLTSMENLRLLMVKNSHVTEINTNLMCIENKTDSSDLHNPKIPCFTNLSTVYITSCHSIKDLTWLLFAPNLVFLRISDSREVEEIINKEKATNLTGITPFQKLEFFSVEKLPKLESIYWSPLPFPLLKHIFAYCCPKLRKLPLNATSVPLVDEFKIEMDSQETELEWEDEDTKNRFLPSIKRRVWVMVNFVKS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
6-911 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SFQCSCDQTLNHIFRWFCGKGYIRNLKKNLTALKREMEDLKAIKDEVQNRVSREEIRHQQRLEAVQVWLTRVDSIDLQIKDLLSTCPVQHQKLCLCGLCSKNVCSSYSFGKRVFLLLEDVKKLNSESNFEVVTKPAPISEVEKRFTQPTIGQEKMLETAWNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKVDLQALGVPIPTRENGCKVAFTTRSREVCGRMGDHKPVEVQCLGPKEAWELFKNKVGDNTLRRDPVIVELARKVAEKCGGLPLALNVIGEVMASKTMVQEWEDAIDVLTTSAAEFPDVKNKILPILKYSYDSLVDENIKTCFLYCALFPEDFNIGMEKLIDYWICEGFIGDYSVIKRARNKGYTMLGTLIRANLLTEVGKTSVVMHDVVREMALWIASDFGKQKENFVVRAGVGLHEIPEIKDWGAVRRMSLMKNNIKEITCGSKCSELTTLFLEENQLKNLSGEFIRCMQKLVVLDLSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSICSVGAISKLSSLRILKLRGSNVHADVSLVKELQLLEHLQVLTITISTEMGLEQILDDERLANCITELGISDFQQKAFNIERLANCITDLEISDFQQKAFNISLLTSMENLRLLMVKNSHVTEINTNLMCIENKTDSSDLHNPKIPCFTNLSTVYITSCHSIKDLTWLLFAPNLVFLRISDSREVEEIINKEKATNLTGITPFQKLEFFSVEKLPKLESIYWSPLPFPLLKHIFAYCCPKLRKLPLNATSVPLVDEFKIEMDSQETELEWEDEDTKNRFLPSIKRRVWVMVNFVK

HMMPanther: PTHR23155:SF109
6-911 PTHR23155:SF109,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

SFQCSCDQTLNHIFRWFCGKGYIRNLKKNLTALKREMEDLKAIKDEVQNRVSREEIRHQQRLEAVQVWLTRVDSIDLQIKDLLSTCPVQHQKLCLCGLCSKNVCSSYSFGKRVFLLLEDVKKLNSESNFEVVTKPAPISEVEKRFTQPTIGQEKMLETAWNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKVDLQALGVPIPTRENGCKVAFTTRSREVCGRMGDHKPVEVQCLGPKEAWELFKNKVGDNTLRRDPVIVELARKVAEKCGGLPLALNVIGEVMASKTMVQEWEDAIDVLTTSAAEFPDVKNKILPILKYSYDSLVDENIKTCFLYCALFPEDFNIGMEKLIDYWICEGFIGDYSVIKRARNKGYTMLGTLIRANLLTEVGKTSVVMHDVVREMALWIASDFGKQKENFVVRAGVGLHEIPEIKDWGAVRRMSLMKNNIKEITCGSKCSELTTLFLEENQLKNLSGEFIRCMQKLVVLDLSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSICSVGAISKLSSLRILKLRGSNVHADVSLVKELQLLEHLQVLTITISTEMGLEQILDDERLANCITELGISDFQQKAFNIERLANCITDLEISDFQQKAFNISLLTSMENLRLLMVKNSHVTEINTNLMCIENKTDSSDLHNPKIPCFTNLSTVYITSCHSIKDLTWLLFAPNLVFLRISDSREVEEIINKEKATNLTGITPFQKLEFFSVEKLPKLESIYWSPLPFPLLKHIFAYCCPKLRKLPLNATSVPLVDEFKIEMDSQETELEWEDEDTKNRFLPSIKRRVWVMVNFVK

superfamily: SSF52540
135-381 SSF52540

EVVTKPAPISEVEKRFTQPTIGQEKMLETAWNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKVDLQALGVPIPTRENGCKVAFTTRSREVCGRMGDHKPVEVQCLGPKEAWELFKNKVGDNTLRRDPVIVELARKVAEKCGGLPLALNVIGEVMASKTMVQEWEDAIDVLTTSAAE

HMMPfam: PF00931
IPR002182
157-436 NB-ARC,NBS
NB-ARC

QEKMLETAWNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKVDLQALGVPIPTRENGCKVAFTTRSREVCGRMGDHKPVEVQCLGPKEAWELFKNKVGDNTLRRDPVIVELARKVAEKCGGLPLALNVIGEVMASKTMVQEWEDAIDVLTTSAAEFPDVKNKILPILKYSYDSLVDENIKTCFLYCALFPEDFNIGMEKLIDYWICEGFI

Gene3D: G3DSA:3.40.50.300
165-268 G3DSA:3.40.50.300

WNRLMEDGVEIMGLHGMGGVGKTTLFHKIHNKFAEIPGRFDVVIWIVVSQGAEISKLQEDIAKKLHLWDEVWKDKTESVNAADIHNVLQRKRFVLMLDDIWDKV

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

VLQRKRFVLMLDDIW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CGGLPLALNVIGEVM

superfamily: SSF52058
471-878 SSF52058,LRR

VMHDVVREMALWIASDFGKQKENFVVRAGVGLHEIPEIKDWGAVRRMSLMKNNIKEITCGSKCSELTTLFLEENQLKNLSGEFIRCMQKLVVLDLSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSICSVGAISKLSSLRILKLRGSNVHADVSLVKELQLLEHLQVLTITISTEMGLEQILDDERLANCITELGISDFQQKAFNIERLANCITDLEISDFQQKAFNISLLTSMENLRLLMVKNSHVTEINTNLMCIENKTDSSDLHNPKIPCFTNLSTVYITSCHSIKDLTWLLFAPNLVFLRISDSREVEEIINKEKATNLTGITPFQKLEFFSVEKLPKLESIYWSPLPFPLLKHIFAYCCPKLRKLPLNATSVPLVDEFKIEMD

Gene3D: G3DSA:3.80.10.10
502-660 G3DSA:3.80.10.10

LHEIPEIKDWGAVRRMSLMKNNIKEITCGSKCSELTTLFLEENQLKNLSGEFIRCMQKLVVLDLSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSICSVGAISKLSSLRILKLRGSNVHADVSLVKELQLLEHLQVLTI

ProfileScan: PS51450
IPR001611
535-556 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELTTLFLEENQLKNLSGEFIRC

FPrintScan: PR00364
IPR000767
555-571 DISEASERSIST
Disease resistance protein

RCMQKLVVLDLSLNRNL

ProfileScan: PS51450
IPR001611
559-581 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLVVLDLSLNRNLNELPEQISEL

HMMPfam: PF13855
565-617 LRR_8,Leucine rich repeat

LSLNRNLNELPEQISELASLQYLDLSSTSIEQLPVGFHELKNLTHLNLSYTSI

ProfileScan: PS51450
IPR001611
583-605 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQYLDLSSTSIEQLPVGFHELK

ProfileScan: PS51450
IPR001611
606-627 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTHLNLSYTSICSVGAISKLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox