PRGDB00063367 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297332168 (GL348714)
Gene Class CNL
Domain Type LRR, NBS
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_2, whole genome shotgun sequence.

DNA Sequence

ATGAAGGATCTGACTTGGCTATTGTTTGCTCCAAATCTTGTGTCCCTACAATTTCAATATTCAGATGAAGTGGAAGAAATTATAAACAAAGAGAAAGCAACCAATCTTACAGCTATTTCACCATTTCAGAAACTAGAAAGCTTATATTTGGTTTATTTGCCTAAGCTGGAGAGTATCTACTGGAGTCCTCTCCCCTTTCCATTATTGAAGCACATAACTGCATATCGCTGTCCAAAGCTGAGAAAGCTTCCCATAAATGCTACAAGTGATTTTGCTAAATCATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_893399 [Arabidopsis lyrata subsp. lyrata].

MKDLTWLLFAPNLVSLQFQYSDEVEEIINKEKATNLTAISPFQKLESLYLVYLPKLESIYWSPLPFPLLKHITAYRCPKLRKLPINATSDFAKS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF109
1-89 PTHR23155:SF109,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MKDLTWLLFAPNLVSLQFQYSDEVEEIINKEKATNLTAISPFQKLESLYLVYLPKLESIYWSPLPFPLLKHITAYRCPKLRKLPINATS

HMMPanther: PTHR23155
1-89 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MKDLTWLLFAPNLVSLQFQYSDEVEEIINKEKATNLTAISPFQKLESLYLVYLPKLESIYWSPLPFPLLKHITAYRCPKLRKLPINATS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox