PRGDB00063369 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 297332168 (GL348714)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

Arabidopsis lyrata subsp. lyrata unplaced genomic scaffold ARALYscaffold_2, whole genome shotgun sequence.

DNA Sequence

ATGACGCACGACGTGTTCCTGAATTTCCGAGGAAAGGAGATGCGCAAAACTTTTGTGAGCCATCTTCTTAGCTCGTTCACGACCAAAAACATCACAAGTTTCATAGTCTCTGATCCTTTCGAGGACCCGGATCTGAAGGCTATGGAACAGTCGCTAGTTGCGATCCCCGTGATATCAAAGAACTACGTGATTTCTAACTTGTGGATGGATGATTTGAGAAAGATAATAGAGTGTGAGAAGATAGGAACTTTGACGGCAATTCCTATATTCTTCCAAGTTAGTCCTTTGGACATCTTACACGCAACAGAAAAATACGCGGACACGCAGGATGAGACCTTGGAGATGGTGAGGAAGTGGTTGTACGCTCAGGTGTCCCGTAAACCTAGCTTCCATTCCAATGACTGGGACGACGACTCCGAGCTGGTGGATAAAATTACGAGTTTCGTTTCTGATATCCTGGAATCTTCCACATCAAGCTATCAAAGTACTGGTTTAAGTCCGGCTCCGAGTTTGAAGCTAGAAAGTGCGTTCAGGGTAAGCAAGTTTATGCACTGGAGATCTCTGTCGCTACCAAGCTCAGCTTTTACACCGATCTCACTGTCTGCATTCAGTCAATTCCCCCTCCTAGACATGAAGGGTCGCTTAGAAAATCTGCGCGCTATGATATTGCGCGTAGAGTCTAGAGCAATTGGTATTTGTGGAATGGAAGGAGTTGGGAAGACAACTCTTGCTAGGCACCTTTACGAGGAGATGGCACCACGATTTCAGCACCATATATATATAAAGAATGTCATTAACAGGTCCCAGTGCCCATTCAGTTTACTAGATATGCTTGCTAGTGAAACTTTCAAGGAAAGTAGCTTCCGCGGGAGCTCTGATAGTGTTGAGTGTCCGAGATACGAGGAAGCTCTTGCTTTCTTCTCAGAATTTGCATTCAAGCAGAGCAGCCCTCTCCCTGTTTTCGAAAGTCTCTCTTTTCGGGCTGTCCATGTCGCTAATCGTCTTCCTCTGGCCCTGAAAGTGTTGGGATCGTATTTACGCGATAGGGAAATAGATGAATGGGAAAGTACATTGCGTAAACTCGAAGCATCACGTGATAACTATGCTTCAGAGGTTAAGAGTTACATCGGAGCAGATGACTATGCACCGAGACGTCCGATCAAAGTGGATCGACACATTGGAGTGGATGAAGCAAATTGTTTCCCGTTATATTGCTTGGCTCTTGAATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein ARALYDRAFT_895140 [Arabidopsis lyrata subsp. lyrata].

MTHDVFLNFRGKEMRKTFVSHLLSSFTTKNITSFIVSDPFEDPDLKAMEQSLVAIPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKYADTQDETLEMVRKWLYAQVSRKPSFHSNDWDDDSELVDKITSFVSDILESSTSSYQSTGLSPAPSLKLESAFRVSKFMHWRSLSLPSSAFTPISLSAFSQFPLLDMKGRLENLRAMILRVESRAIGICGMEGVGKTTLARHLYEEMAPRFQHHIYIKNVINRSQCPFSLLDMLASETFKESSFRGSSDSVECPRYEEALAFFSEFAFKQSSPLPVFESLSFRAVHVANRLPLALKVLGSYLRDREIDEWESTLRKLEASRDNYASEVKSYIGADDYAPRRPIKVDRHIGVDEANCFPLYCLALE

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
2-105 G3DSA:3.40.50.10140

THDVFLNFRGKEMRKTFVSHLLSSFTTKNITSFIVSDPFEDPDLKAMEQSLVAIPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKY

superfamily: SSF52200
IPR000157
3-122 TIR
Toll-Interleukin receptor

HDVFLNFRGKEMRKTFVSHLLSSFTTKNITSFIVSDPFEDPDLKAMEQSLVAIPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKYADTQDETLEMVRKWLYA

HMMPfam: PF01582
IPR000157
5-118 TIR
Toll-Interleukin receptor

VFLNFRGKEMRKTFVSHLLSSFTTKNITSFIVSDPFEDPDLKAMEQSLVAIPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKYADTQDETLEMVRK

HMMPanther: PTHR11017:SF20
55-367 PTHR11017:SF20,SUBFAMILY NOT NAMED

IPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKYADTQDETLEMVRKWLYAQVSRKPSFHSNDWDDDSELVDKITSFVSDILESSTSSYQSTGLSPAPSLKLESAFRVSKFMHWRSLSLPSSAFTPISLSAFSQFPLLDMKGRLENLRAMILRVESRAIGICGMEGVGKTTLARHLYEEMAPRFQHHIYIKNVINRSQCPFSLLDMLASETFKESSFRGSSDSVECPRYEEALAFFSEFAFKQSSPLPVFESLSFRAVHVANRLPLALKVLGSYLRDREIDEWESTLRKLEASRDN

HMMPanther: PTHR11017
55-367 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IPVISKNYVISNLWMDDLRKIIECEKIGTLTAIPIFFQVSPLDILHATEKYADTQDETLEMVRKWLYAQVSRKPSFHSNDWDDDSELVDKITSFVSDILESSTSSYQSTGLSPAPSLKLESAFRVSKFMHWRSLSLPSSAFTPISLSAFSQFPLLDMKGRLENLRAMILRVESRAIGICGMEGVGKTTLARHLYEEMAPRFQHHIYIKNVINRSQCPFSLLDMLASETFKESSFRGSSDSVECPRYEEALAFFSEFAFKQSSPLPVFESLSFRAVHVANRLPLALKVLGSYLRDREIDEWESTLRKLEASRDN

Gene3D: G3DSA:3.40.50.300
109-127 G3DSA:3.40.50.300

QDETLEMVRKWLYAQVSRK

superfamily: SSF52540
215-261 SSF52540

LENLRAMILRVESRAIGICGMEGVGKTTLARHLYEEMAPRFQHHIYI

Gene3D: G3DSA:3.40.50.300
217-263 G3DSA:3.40.50.300

NLRAMILRVESRAIGICGMEGVGKTTLARHLYEEMAPRFQHHIYIKN

HMMPfam: PF00931
IPR002182
295-370 NB-ARC,NBS
NB-ARC

VECPRYEEALAFFSEFAFKQSSPLPVFESLSFRAVHVANRLPLALKVLGSYLRDREIDEWESTLRKLEASRDNYAS

Gene3D: G3DSA:3.40.50.300
303-371 G3DSA:3.40.50.300

ALAFFSEFAFKQSSPLPVFESLSFRAVHVANRLPLALKVLGSYLRDREIDEWESTLRKLEASRDNYASE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox