PRGDB00063414 (AT5G17680-like protein)

From PRG Wiki
Jump to: navigation, search
AT5G17680-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 295830834 (GU949265)
Gene Class Unknown
Domain Type LRR
Gene Species Capsella grandiflora

Comment?

Capsella grandiflora clone Cg935_13_TS2_AT5G17680_636 AT5G17680-like protein gene, partial cds.

DNA Sequence

TGTTCTTTACTGGAGAGTTTTCCACCAGAAATCTGTCAGACAATGAGCTGCTTGAGGTGGTTTGATTTAGATCGGACTAGTATTAAAGAACTACCTGAAAACATTGGGAATTTAGTAGCTCTTGAGGTKCTTCAAGCCAGTAAAACAGTTATAAGGCGAGCACCTTGGTCCATTGCAAAACTTTCTCGTCTTCAACTTTTAGCTATTGGGAATAGTTCCTATACTCCAGAAGGTTTGTTGCATTCTGCTTGTCCTCCCTTATCAAGGTTTGATGACTTGAGAGCTCTGAGCCTAAGCAACATGAACATGATAGAGATCCCWAACAGTATTGGTAACTTATGGAATCTGCTAGAACTAGATCTGAGTGGAAACAATTTCAARTTCGTCCCTGCAAGCATCAAACGGCTCACCAAGTTGAACAGACTGAATTTAAACAATTGCCAGAGACTTCAGGCATTGCCCGATGAGCTTCCACGAGGTCTCTTGTATATCTACATCCATGGCTGCACATCCCTAGTAAGTATCTCAGGTTGCTTCAACCAATATTGT


Protein sequences

Name Description Sequence
AT5G17680-like protein AT5G17680-like protein [Capsella grandiflora].

CSLLESFPPEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASKTVIRRAPWSIAKLSRLQLLAIGNSSYTPEGLLHSACPPLSRFDDLRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNCQRLQALPDELPRGLLYIYIHGCTSLVSISGCFNQYC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF252
4-175 PTHR23155:SF252,SUBFAMILY NOT NAMED

LESFPPEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASKTVIRRAPWSIAKLSRLQLLAIGNSSYTPEGLLHSACPPLSRFDDLRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNCQRLQALPDELPRGLLYIYIHGCTSLVSI

Gene3D: G3DSA:3.80.10.10
4-72 G3DSA:3.80.10.10

LESFPPEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASKTVIRRAPWSIAKLSRLQLLAIGNS

HMMPanther: PTHR23155
4-175 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LESFPPEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASKTVIRRAPWSIAKLSRLQLLAIGNSSYTPEGLLHSACPPLSRFDDLRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNCQRLQALPDELPRGLLYIYIHGCTSLVSI

superfamily: SSF52047
7-183 SSF52047,LRR

FPPEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASKTVIRRAPWSIAKLSRLQLLAIGNSSYTPEGLLHSACPPLSRFDDLRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNCQRLQALPDELPRGLLYIYIHGCTSLVSISGCFNQYC

Gene3D: G3DSA:3.80.10.10
87-169 G3DSA:3.80.10.10

LSRFDDLRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNCQRLQALPDELPRGLLYIYIHGC

HMMPfam: PF13855
93-147 LRR_8,Leucine rich repeat

LRALSLSNMNMIEIPNSIGNLWNLLELDLSGNNFKFVPASIKRLTKLNRLNLNNC


List of References

Tanja Slotte, John Paul Foxe, Khaled Michel Hazzouri, Stephen I Wright
Genome-wide evidence for efficient positive and purifying selection in Capsella grandiflora, a plant species with a large effective population size.
Mol. Biol. Evol.: 2010, 27(8);1813-21
PubMed:20194429 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox