PRGDB00063429 (PR-protein)

From PRG Wiki
Jump to: navigation, search
PR-protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22324573 (AF525144)
Gene Class Unknown
Domain Type
Gene Species Capsicum annuum

Comment?

Capsicum annuum clone C22 PR-protein gene, partial cds.

DNA Sequence

AGGAATAAGTTGCACGGGCCGATAAAATATTCAAGGACAAACAACTCGTTTGCTCAAATTCGAGTCATAGATCTCTCATCCAATGGATTTAGTGGAAAATTACCAGTGAGCCTTTTTGAGATTTTTCAAGCCATGAAAATCATTAGTGGAACCCGAGAGTATATAGCAGATTATTCTGGTAATTATGCAAATACTTTGATAGTGATAACAAAGGGACTGGATAGGGAACTTCCTTGA


Protein sequences

Name Description Sequence
PR-protein PR-protein [Capsicum annuum].

RNKLHGPIKYSRTNNSFAQIRVIDLSSNGFSGKLPVSLFEIFQAMKIISGTREYIADYSGNYANTLIVITKGLDRELP







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox