PRGDB00063438 (unknown protein)

From PRG Wiki
Jump to: navigation, search
unknown protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13346556 (AC024594)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0093B11 genomic sequence, complete sequence.

DNA Sequence

GGCAACACGCAAGAAGAGCTCCCGGAGTTCCTCCTGGGCACCTGCCGACTGAACTACCTCGACGCGTCCAAGGCAGTGTCCATAGACGAGTGCTGACTTGGAGTTGATATAGGCTCGTCAACAGTTGCACGGGGTGTGGTGAGCCTTGTGCTTGGCTACTTGAACAACCTGGTGATTGAAATGGCCTTCCTGGTACAGGGGTCTTGGATAGTAAAGCAAAGTGTGGGAAAGAAAGCCTGTTTGGTTGGTCAAGCACTAGAGATCAATTATTTCCGTGGAAGCAATTATTTGGAGGTTCCTGGTTCATCCACATACAGCTTAGCCTTGTATTATATGATGGATACCCCATTGGAAAAGGTTCCTCTACTTGAAAGATTTGTAAATGGAGATGACGCATTCAGAAATTCAAGGTTCAAACTCATCCCGTACATCTCAAAGAAATGTGCAGCACAAGGGGGCAACAAATTCTTTTTTATCGTTAACATACAGATCAAGGCAAACAATACATTGATGCAAATGGTAGGTGCTGACTGGATAAAATCTGATAAGCGTGAAGATGACCTTTCTGGCCGCCCTGGAGGACTAGTACAGTGCAAAAGAGAGGATATGTTGACTTACAAGGAGCTGCTGATTTCGATAATGGTCCATTTTGCTATGGATATACTCTTCCAAAAGATTCGAACTGTACAATGCCTTCTACTTGGGCAATGACAGATCCTACAACATTCTTAATCCGAGGGGAGTCATATTTGCAGGATCGTCTAAAGGACCAACGACATGCTAAATTGTCCACCGCTGCTGTCTTCGTAAAAAAGTTGCATGATCTTGCAGCCCTGCGGGAATTCTTCCGAGCAAAAAATGGAAATTGTGCTTGCATAGAGTTCTCGTCAGGTGAGTTGACAAGGGATATGCGTCTGCAACAAGGTGAAAATGAGCGGATAAAAATCGAAATGCTGTCAGCAAGTGAAAATAACAGGCTAGAAGATCCTACAGAAGGATCACTGGGTGGTTCTAATAGACACTTAAGTAGCGCTGGTTCCTTCATTCAACTGAACGATGCAGCGGATGAGTTTTTTGATGTCCCGGATGATTCAGAATATGATCAAAGAGAAGCCATGTGGCCTTCCGATGAGAGCACACATTCTGTGGTGGAGGATATGTAATATCGCCAGTCAATCAAGGAAAACAATCGGTTGTGAAGCATATGCTTGCTATAGATTGGAAATTCTGGAAGTCTTATCTGTTTACCGCATCTGCAAAACACATCACTATACGCATGCTAGGAAGAGTAGCAGTTATTCTATACCACTCTGTTTTCCACTACAGATGCCGTTCTGAGAGAGGCTATGTCCGTGCATGTCTTAAAAGGGAATGAGAAAGAGGGATCTATTACTTAGGCGATATTGGAGGAGAGAAGACGATGGGACTTATGGTGGGACTTCTGTTTGCAGGAAGGGAGGGTGGTGGAGCATATAGATGGTCATACAGATATAATCCACAAGAAATTAAGAGACGGCTGGTTACCATGTATTGGGATGATCATCCAGCTATAATGGCTGTTGGTGTTGTTGATGCGAATTCTGAGGCTGTATTCCAGACTGTAATGTCCCTTGGTCAATCAAGATCAGAGATTGCGTTTGTTTACTGAGGCAAAGGATGGTGGTTCAGAGGGGAAGATTGGACTGTATTTTCTTCTGTCCATAACGATCCTATGGCATCTGATGTTATTGCGCCTTCTCCATGGACAATATTTGGCTGCAAAAATGGCTAAGCCGCCGCAGTAACCGCATGCACTCAATAGTCCCCAAGAAAAGATGAGCATATTGTTGCTTGTTCACATAGAAGATGGCAAGCTTTTAGTTGGGTGCTCGAAGTTCAGAGGAAGCCGCTAGGTGGATCAGGTGTTTGATGGAGTCTGCCTTAAAGGTTTTTTACATATTCACACTCTACAATGCCTCTAATCATTATGATCAACTTAAGGATCCTGTTAGAAGTGCAATAATTGATTCTTGTATACGTGTCACAGACAATGGGAGAGAAAGTGTTCATAGAAGTATGATGGGAGGGGTGGCGGCAGAGGTGGTGGTGGAGGACGCTGCCGCGGCGGCGGCAGCTGTGCCCGCGGCGGCGGTGGCGGGGACGGGAGCGGGAGGGGGGGAGGAGGGGAGGATGCGGATGGAGGGGTGGCTGTACCTGATCCGATCCAACCGCCTCGGCCTGCAGTACTCGCGGAAGAGGTACTTCGTGCTCGAGGACGCCGCGCTCCGCTGCTTCAAGGCCCCGCCGCCGCCCTCCTCCTCCTCCTCCTCCTCCAAGCGCGAG


Protein sequences

Name Description Sequence
unknown protein unknown protein [Oryza sativa Japonica Group].

MMGGVAAEVVVEDAAAAAAAVPAAAVAGTGAGGGEEGRMRMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDEHIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAKNGNCACIEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAMWPSDESTHSVDQRHAKLSTAAVFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLNYLDASKAVSIDEC


Domains

Domain Start-End Description Sequence

superfamily: SSF50729
32-159 SSF50729

GGGEEGRMRMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKD

Gene3D: G3DSA:2.30.29.30
IPR011993
37-152 PH_type
Pleckstrin homology-type

GRMRMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESA

ProfileScan: PS50003
IPR001849
38-153 PH_DOMAIN
Pleckstrin homology domain

RMRMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESAL

HMMSmart: SM00233
IPR001849
39-155 PH
Pleckstrin homology domain

MRMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKS

HMMPfam: PF00169
IPR001849
40-151 PH
Pleckstrin homology domain

RMEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMES

HMMPanther: PTHR12136
91-397 PTHR12136,STEROIDOGENIC ACUTE REGULATORY PROTEIN (STAR)

PVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDEHIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFF

HMMPanther: PTHR12136:SF13
91-397 PTHR12136:SF13,SUBFAMILY NOT NAMED

PVRSAIIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDEHIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFF

ProfileScan: PS50848
IPR002913
187-366 START
Lipid-binding START

WTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAID

HMMSmart: SM00234
IPR002913
197-399 START
Lipid-binding START

PMASDVIAPSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRA

superfamily: SSF55961
204-402 SSF55961

APSPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAKNG

Gene3D: G3DSA:3.30.530.20
IPR023393
206-399 G3DSA:3.30.530.20
START-like domain

SPWTIFGCKNGLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRA

HMMPfam: PF01852
IPR002913
235-370 START
Lipid-binding START

DHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFW

HMMPfam: PF07059
IPR009769
556-763 DUF1336
Domain of unknown function DUF1336

WAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLNYLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox