PRGDB00063444 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13310466 (AF338969)
Gene Class NL
Domain Type NBS, LRR
Gene Species Brassica rapa

Comment?

Brassica rapa cultivar R500 disease resistance-like protein (RGA5) gene, partial cds.

DNA Sequence

TGATGGGGTTGACATAGTGATTTGGGTTGTAGTGTCTAAGGTTAAACGGAACGAGAAGATTCAAGACGAGATCGCTGAGAAACTAGGCATCTTTGAAGGGGAGTCATGGAAACACAAGACGGAGGACCAAAAAGCCTATAGTATACGCAATTCGCTGAAGACCAAACGATTTGTGTTGTTTTTGGATGACATTTGGAGCAAAGTGGAATTAAAAGGTATAGGTGTTCCATTTCCCACAAAGGAAAACAAATGCAAAATTGTATTCACCACTCGTTCAAGGGAAGTGTGTGCACTCATGGGGGAYACNAACCCAGTCGAAGTCAGC


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica rapa].

DGVDIVIWVVVSKVKRNEKIQDEIAEKLGIFEGESWKHKTEDQKAYSIRNSLKTKRFVLFLDDIWSKVELKGIGVPFPTKENKCKIVFTTRSREVCALMGDTNPVEVS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF119
2-82 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

GVDIVIWVVVSKVKRNEKIQDEIAEKLGIFEGESWKHKTEDQKAYSIRNSLKTKRFVLFLDDIWSKVELKGIGVPFPTKEN

HMMPanther: PTHR23155
2-82 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVDIVIWVVVSKVKRNEKIQDEIAEKLGIFEGESWKHKTEDQKAYSIRNSLKTKRFVLFLDDIWSKVELKGIGVPFPTKEN

HMMPfam: PF00931
IPR002182
4-106 NB-ARC,NBS
NB-ARC

DIVIWVVVSKVKRNEKIQDEIAEKLGIFEGESWKHKTEDQKAYSIRNSLKTKRFVLFLDDIWSKVELKGIGVPFPTKENKCKIVFTTRSREVCALMGDTNPVE


List of References

M Fourmann, F Chariot, N Froger, R Delourme, D Brunel
Expression, mapping, and genetic variability of Brassica napus disease resistance gene analogues.
Genome: 2001, 44(6);1083-99
PubMed:11768212 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox