PRGDB00063483 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12321249 (AC079604)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T15M6 genomic sequence, complete sequence.

DNA Sequence

ATGTTGATATTCACTATACCGCAGTTTTTCTTCGCAGCATGGGTCATGGTTGTATCACTACAAATGCAAGGGTATATAAGTTGCATCGAGAAGGAGAGGAAGGGATTGTTGGAGCTCAAGGCTTATGTGAACAAGGAATATTCATATGATTGGTCTAATGACACGAAGAGTGATTGTTGCCGATGGGAAAGAGTGGAGTGTGATCGTACAAGTGGACGTGTGATCGGCCTCTTCTTGAATCAAACATTCAGTGATCCAATCCTGATAAATCTTTCCTTGTTTCACCCCTTTGAAGAATTGCGGACTTTAAACTTATATGATTTCGGATGCACAGGCTGGTTCGATGATATCCATGGGTATAAAAGCCTTGGGAAATTAAAAAAACTTGAGATCCTCGATATGGGTAACAACGAAGTCAATAACAGTGTCTTACCCTTTCTAAATGCCGCTTCTTCGCTTAGAACTTTAATTCTTCATGGAAACAATATGGAAGGTACTTTTCCAATGAAAGAGCTAAAAGACTTGAGTAATCTAGAACTGTTGGATCTAAGTGGGAACTTGCTCAATGGCCCTGTGCCAGGTACTACTAAAGTTTTTATTCACCTCTCATTCTCTTTTCAAATATTCATCTTAGTTAACCTTTGTCAAAAATATATATACTGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGTTKVFIHLSFSFQIFILVNLCQKYIY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-204 PTHR24420:SF473,SUBFAMILY NOT NAMED

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGTTKVFIHLSF

HMMPanther: PTHR24420
1-204 PTHR24420,FAMILY NOT NAMED

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGTTKVFIHLSF

superfamily: SSF52058
26-202 SSF52058,LRR

ISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGTTKVFIHL

HMMPfam: PF08263
IPR013210
31-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECD

Gene3D: G3DSA:3.80.10.10
51-197 G3DSA:3.80.10.10

WSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGTTK

HMMPfam: PF00560
IPR001611
177-192 LRR_1
Leucine-rich repeat

NLELLDLSGNLLNGPV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox