PRGDB00063505 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10998935 (AC069299)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T1E4 genomic sequence, complete sequence.

DNA Sequence

ATGAACTCTTGTTGCTTCCCTCTCTTCATCTTTGCATTCGTTATCTTTCTCCGGTGTTTAAGTCCCATTGAAGCTGCCACGTGTCATCCTGATGACGAGGCGGGTCTTTTAGCTTTTAAATCGGGTATAACTCAAGATCCTACGGGTATTCTCAGCTCTTGGAAGAAAGGTACTGACTGCTGTTCATGGAAGGGTGTCGGTTGTCTCACCAACCGCGTCACCGGACTCACTATCAACGGACAATCTGATGTTACTGGAAGCTTTCTTTCTGGCACTATCTCGCCGTCATTGGCCAAACTCCAACACCTTGTTGGTATTTACTTCACCAATCTTCGAAACATCACTGGTTCTTTTCCTCAATTCCTTTTCCAATTACCAAATGTAAAACAAGTCTACTTCACGAATAGCCGTCTCTCCGGTCCTCTTCCAGCTAACATTGGTGCGCTAAGCGAGTTAGGAGAACTAAGTCTCGACGGAAACCTGTTTACTGGTCCGATCCCGAGTTCCATTTCCAATTTAACCCGGTTATATCTGCTCAATCTTGGAGATAATCTCTTAACCGGAACTATACCTTTAGGTCTTGCTAATCTCAAGATCTTGTTGTCACTCAACTTTGGCAACAATCGTCTCTCTGAAACCATACCGGATATTTTCAAATCCATGCAGAAGCTCCAATCTCTAACCCTCTCCCGCAACAAATTCTCTGGAAATCTTCCTCCGTCCATTGCATCACTCAAACCAATTCTCAATTACCTCGATCTAAGCCAGAATAATCTCTCTGGGACAATCCCGACCTTTTTATCAAACTTCAAGGTACTAGACTCATTGGATCTTTCTAGAAATAGGTTCTCTGGGGTTGTTCCGAAGAGTTTAGCCAATATGCCTAAACTTTTCCATCTCAATCTCTCCCACAATTTTCTAACTGGTCCACTCCCTGCCATGAAGAACGTTGATGGCCTTGCCACTCTAGATCTTTCATACAACCAATTTCACCTCAAAACGATACCGAAATGGGTGACCTCGTCGCCGTCCATGTACTCGTTGAAGCTGGTAAAATGCGGGATCAATATGAGCTTAGACAATTGGAAGCCAGTGAGACCCAATATTTACTTTTACATCGATCTGTCAGAAAACGAGATCTCAGGGAGTCTAACATGGTTCTTCAACCTAGCGCATAACCTATATGAGTTTCAAGCGTCAGGGAACAAACTTCGATTCGACATGGGGAAGCTGAATTTAAGTGAGAGACTAGAAAGCCTCGATCTATCAAGGAATTTGATATTTGGGAAGGTACCAATGACCGTGGCTAAACTGCAAAAATTGAACTTGAGTCATAACCATCTTTGTGGAAAGCTTCCAGTGACTAAATTCCCGGCCAGCGCGTTTGTCGGTAATGACTGTCTCTGCGGCTCTCCGCTTTCTCCTTGTAAAATTTAG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MNSCCFPLFIFAFVIFLRCLSPIEAATCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFLTGPLPAMKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPVRPNIYFYIDLSENEISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-475 PTHR24420,FAMILY NOT NAMED

MNSCCFPLFIFAFVIFLRCLSPIEAATCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFLTGPLPAMKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPVRPNIYFYIDLSENEISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
1-475 PTHR24420:SF510

MNSCCFPLFIFAFVIFLRCLSPIEAATCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFLTGPLPAMKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPVRPNIYFYIDLSENEISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

superfamily: SSF52058
26-365 SSF52058,LRR

ATCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFLTGPLPAMKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPV

Gene3D: G3DSA:3.80.10.10
27-323 G3DSA:3.80.10.10

TCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHNFLTGPLPAMKNVDGLATL

HMMPfam: PF08263
IPR013210
30-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKSGITQDPTGILSSWKKGTDCCSWKGVGC

HMMPfam: PF00560
IPR001611
223-245 LRR_1
Leucine-rich repeat

KLQSLTLSRNKFSGNLPPSIASL

FPrintScan: PR00019
249-262 LEURICHRPT,Leucine-rich repeat signature

LNYLDLSQNNLSGT

HMMPfam: PF13855
249-305 LRR_8,Leucine rich repeat

LNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHLNLSHN

Gene3D: G3DSA:3.80.10.10
324-378 G3DSA:3.80.10.10

DLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLDNWKPVRPNIYFYIDLSEN

superfamily: SSF52058
372-477 SSF52058,LRR

YIDLSENEISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCK

Gene3D: G3DSA:3.80.10.10
379-458 G3DSA:3.80.10.10

EISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESLDLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFP

FPrintScan: PR00019
435-448 LEURICHRPT,Leucine-rich repeat signature

VAKLQKLNLSHNHL

HMMPfam: PF00560
IPR001611
437-457 LRR_1
Leucine-rich repeat

KLQKLNLSHNHLCGKLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox