PRGDB00063507 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10998935 (AC069299)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T1E4 genomic sequence, complete sequence.

DNA Sequence

ATGGATTGGTCAAAAACGTCAACTTTGACTTCGCAGCTCTCAAGTAATCTTTTCCCCACTACTAATAGCTCTCTTCTCTCAATCAACACAACACAATTCACCACCATGAACTCTTCCTTTACTCTCTTCATCTTTACCTTCGTCATCTTCCTCCAATGTCTAAATCCCACCGGAGCTGCCACGTGTCATCCTGATGATGAAGCGGGTCTTCTAGCTTTCAAAGCGGGTATAACCCGAGATCCTTCGGGTATTCTCAGTTCTTGGAAGAAAGGTACCGCTTGTTGTTCTTGGAACGGTGTCACTTGTCTCACCACTGACCGTGTCTCTGCACTCTCTGTCGCTGGACAAGCCGATGTTGCTGGAAGCTTCCTCTCCGGCACTCTCTCGCCGTCGTTGGCTAAACTCAAGCACCTTGATGGGATTTACTTCACCGATCTCAAGAACATCACTGGTTCTTTTCCTCAATTCCTTTTCCAATTACCAAATCTTAAGTACGTATACATTGAGAATAACCGTCTCTCTGGTACTCTTCCGGCTAACATCGGTGCGCTAAGCCAGCTTGAAGCGTTCAGCCTCGAGGGAAACCGGTTCACCGGTCCGATCCCGAGCTCGATATCTAATTTGACTCTGTTAACTCAACTCAAACTCGGCAATAATCTCCTAACCGGAACTATACCGTTAGGGGTCGCTAATCTCAAGCTCATGTCGTATCTCAACCTTGGAGGTAACCGTCTCACTGGAACCATTCCAGATATTTTCAAATCCATGCCAGAGCTCCGATCTTTAACTCTCTCCCGCAACGGATTCTCCGGGAATCTTCCTCCGTCCATTGCATCACTCGCACCGATTCTTAGGTTCCTCGAGTTAGGCCATAACAAACTCTCCGGGACGATTCCAAACTTTTTATCAAACTTCAAGGCGCTCGACACATTGGATCTCTCCAAGAATCGGTTCTCGGGTGTCATACCGAAGAGTTTCGCCAATCTGACCAAGATATTCAATCTTGATCTCTCCCATAATCTTCTAACCGATCCATTCCCTGTCTTGAACGTTAAAGGCATTGAATCTTTGGATCTTTCTTACAACCAGTTTCACTTGAATACGATCCCGAAATGGGTGACTTCGTCGCCGATCATCTTCTCGTTGAAGCTAGCAAAATGCGGGATCAAGATGAGCTTAGACGATTGGAAGCCAGCGCAAACATTCTACTATGATTTCATCGATCTGTCGGAAAACGAGATCACAGGGAGTCCAGCAAGGTTCTTGAACCAAACAGAGTATCTAGTGGAGTTCAAGGCAGCGGGTAACAAACTACGATTCGATATGGGGAAGCTAACGTTTGCAAAGACGCTGACAACTTTAGATATATCAAGGAACTTGGTATTTGGGAAGGTGCCGGCAATGGTGGCTGGACTAAAGACATTGAACGTGAGTCACAACCATCTTTGTGGAAAGCTTCCAGTAACAAAGTTCCCGGCCAGTGCGTTTGTGGGTAATGACTGTCTTTGCGGCTCTCCTCTTTCTCCTTGTAAAGCTTAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MDWSKTSTLTSQLSSNLFPTTNSSLLSINTTQFTTMNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
25-509 PTHR24420,FAMILY NOT NAMED

LLSINTTQFTTMNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPanther: PTHR24420:SF510
25-509 PTHR24420:SF510

LLSINTTQFTTMNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

superfamily: SSF52058
60-399 SSF52058,LRR

ATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPA

Gene3D: G3DSA:3.80.10.10
61-280 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASL

HMMPfam: PF08263
IPR013210
64-102 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

HMMPfam: PF00560
IPR001611
162-184 LRR_1
Leucine-rich repeat

NLKYVYIENNRLSGTLPANIGAL

HMMPfam: PF00560
IPR001611
237-255 LRR_1
Leucine-rich repeat

YLNLGGNRLTGTIPDIFKS

HMMPfam: PF00560
IPR001611
259-280 LRR_1
Leucine-rich repeat

LRSLTLSRNGFSGNLPPSIASL

Gene3D: G3DSA:3.80.10.10
284-509 G3DSA:3.80.10.10

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPfam: PF13855
284-342 LRR_8,Leucine rich repeat

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLL

superfamily: SSF52058
350-487 SSF52058,LRR

NVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLP

HMMPfam: PF00560
IPR001611
472-491 LRR_1
Leucine-rich repeat

LKTLNVSHNHLCGKLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox