PRGDB00063580 (NBS-LRR-like protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 251737936 (GQ229458)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza rufipogon

Comment?

Oryza rufipogon NBS-LRR-like protein (NLRH4) gene, partial cds.

DNA Sequence

GGGGGGTGGGGGAAGACGACACTTGCTCGATTGGTGTACCATGACCCAGAAGTAAAAGATAAATTTGACATCATGCTCTGGATCTACGTATCTGCTAACTTTGATGAAGTTAAGCTTACACAAGGGATTCTGGAACAAATACCTGAATGTGAGTTCAAAAGCGCCAAGAATCTCACTGTGCTTCAGCGTGGTATCAACAAATATTTGACCAAAAGATTTCTGCTTGTTCTGGATGACATGTGGGAAGAGAGTGAGGGTCGTTGGGACAAGTTATTGGCCCCACTTAGATCCGCACAGGCTAAGGGTAACGTACTCTTGGTAACTACTCGGAAGTTATCGGTGGCTAGGATAACTAGCAACACAGAAGCACACATTGACTTGGATGGTATGAAAAAAGATGACTTCTGGTTATTCTTCAAAAGATGCATATTTGGTGATGAAAACTATCAAGGCCAAAGGAAGCTACAGAATATTGCTAAGAAAATAGCCACCAGACTGAATGGCAATCCCCTCCGCCGC


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Oryza rufipogon].

GGWGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPLRR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
1-171 PTHR11017:SF28

GGWGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPL

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

GGWGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPL

superfamily: SSF52540
1-163 SSF52540

GGWGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIA

HMMPanther: PTHR11017
1-171 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGWGKTTLARLVYHDPEVKDKFDIMLWIYVSANFDEVKLTQGILEQIPECEFKSAKNLTVLQRGINKYLTKRFLLVLDDMWEESEGRWDKLLAPLRSAQAKGNVLLVTTRKLSVARITSNTEAHIDLDGMKKDDFWLFFKRCIFGDENYQGQRKLQNIAKKIATRLNGNPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox