PRGDB00063595 (L-aspartate oxidase)

From PRG Wiki
Jump to: navigation, search
L-aspartate oxidase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342091 (FJ817291)
Gene Class Unknown
Domain Type NBS
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC B4-410, complete sequence.

DNA Sequence

GTTTGTTCAGTTCCATCCAACTGCCTTAGCTGATGAAGGGCTTCCTATCAAACAAACCAAGCCTAGGGAAAAAGCATTTCTGATATCCGAAGCGGTTAGAGGTGATGGGGGCATCCTTTATAATTTAGGCATGGAAAGATTCATGCCCTTGTATGATGAGAGGGCAGAGCTTGCTCCAAGGGATGTTGTGGCTAGAAGCATAGATGACCAACTTAAAAAGCGTGATGAGAAGTATGTTCTTCTTGATATAAGTCACAAGCCGAAGGAGGAAATCCTCTCCCATTTTCCCAACATTTCATCTACGTGTCTCAAGTATGGTTTGGACATAACTCGTCACCCGATCCCGGTTGTTCCAGCTGCTCATTACATGTGTGGAGGAGTTCAAGCTGGTCTTCAAGGAGAGACCAATGTGAAAGGTCTGTATGTAGCTGGTGAGGTAGCATGCACAGGTTTGCACGGAGCAAACAGACTTGCTAGCAACTCATTGCTTGAGGCACTCGTTTTTGCAAGAAGAGCTGTGCAGCCCTCAGTTGATTGGATGAAGAGCTCTAGCCTTGATCTGACTGCATCAAACTTGTGGCCTCGACCTGCTGCTGCGCCTTTGTCGCTCGAAAGTAATGTCACTGACAAGATTCTGTCAATGACAAAGGAATCGAGGACAGAACTGCAATCCATCATGTGGAACTATGTAGGAATTGTTCGGTCGACGATGAGACTAGAGACAGCAAAGCAAAACATTTGCAACTTGGAGGCTAAATGGGAGGAGTGCTTGTTTGAGCATGGATGGAAGCCAACAATGGCAGGTCCTGAGATCTGTGAGATGAGAAACCTCTTTTGCTGCGCAAAGCTGGTGATCAGCAGTGCTCTTTCGAGGCACGAGAGTCGAGGACTGCATTACACAGTTGATTTTCCTCATCTTGAGGAAAGCAAGAGACTTCCAACAATCATTTTTCCAAGTTCAACTGTAAACAGTACATGGAGTTCTCGACAATTACACAAGCAGCCCATGTACCAGGAAGGCATCAAATTGTGTCACAATACATATAAATAGGTAGCCACTGGAGATGGAATTGCCATGGCTCATCGAGCTCAAGCTTTGATTTCCAACATGGAGTGATAAGATTTCTTTCAAAGGCGACTTTACTTGCATCTGGTGGAGCAGGGCATATTTATCCCAAAACTACAAATCCTCTGGATGAATCTGACATAATTTGTCTTGGTGTTGACACGCTGAACACTAAAACCCTAGAGGTGGGAACAGCAGTTGTCTGTACTGAAGGACCTGAAAGAGTCAGAGAATTAATTGCTATGGGTGCATCATTTGACCATGGGGAAGATGGTAACTTGCATCTTATGAGGGAGGGAGGTCATTCACATCATAGAATTGTTCATGCTGCTGATATGACTGGAAAGGAGATTGAACGTGCTCTACTGAAGGCAGTTATCAACAATCCTAATATTTTTGTGTTTGAACACCATTTTGCTATTGATCTTCTTACTTGTCAGGTCTAAAGCAGTATCCAAACACGTTTGTGCATTTTCTGCACCTCCACTTCAAAAGAATCAGAAACTCTTCAAAATCGTTTCCTCTTGCAAGATAGATAGTCTCACACAGTGCTTTGACTTTTCCATTATTGGGAGTGGGATTGCTGGTCTCCGCTATGCGCTTGAAGTTGCAAAATATGGATCTGTTGCAGTGATAACCAAGGCTGAGTCTCACGAATGCAATACTAATTATGCTCAAGGTGGTGTTAGTGCTGTGCTAGGCCCTTCAGATTCTGTGGAGAGTCACATGAAGGACACCATTGTAGCTGGGGCATATCTTTGTGATGAGGAAAGCGTCCGAATGCAGTCGCCTACTTGTATTGCAATGGCGACTTGGATACCTGCTGGAAGTGGCACACTGCAATTTAGAGTGACAAACTGCAAGGGACACAGTTGTAGAAGGACTGCTTTGGTTTCTGATGCCCCAATCGCGAGATTCTTACGAAAAGATCTTTCATG


Protein sequences

Name Description Sequence
L-aspartate oxidase L-aspartate oxidase [Phaseolus vulgaris].

MQSPTCIAMATWIPAGSGTLQFRVTNCKGHSCRRTALVSDAPIARFLRKDLSWSKAVSKHVCAFSAPPLQKNQKLFKIVSSCKIDSLTQCFDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVDWMKSSSLDLTASNLWPRPAAAPLSLESNVTDKILSMTKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPHLEESKRLPTIIFPSSTVNSTWSSRQLHKQPMYQEGIKLCHNTYK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11632
83-659 PTHR11632,SUCCINATE DEHYDROGENASE 2 FLAVOPROTEIN SUBUNIT

KIDSLTQCFDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVDWMKSSSLDLTASNLWPRPAAAPLSLESNVTDKILSMTKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPHLEESKRLPTIIFPSSTVNSTWSSRQLHKQPMYQEGI

HMMPanther: PTHR11632:SF6
83-659 PTHR11632:SF6,L-ASPARTATE OXIDASE

KIDSLTQCFDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVDWMKSSSLDLTASNLWPRPAAAPLSLESNVTDKILSMTKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPHLEESKRLPTIIFPSSTVNSTWSSRQLHKQPMYQEGI

superfamily: SSF51905
87-500 SSF51905

LTQCFDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVDWMKS

Gene3D: G3DSA:3.50.50.60
91-321 G3DSA:3.50.50.60

FDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQ

HMMTigr: TIGR00551
IPR005288
91-622 NadB
L-aspartate oxidase

FDFSIIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVDWMKSSSLDLTASNLWPRPAAAPLSLESNVTDKILSMTKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFP

FPrintScan: PR00368
IPR013027
93-112 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

FSIIGSGIAGLRYALEVAKY

HMMPfam: PF00890
IPR003953
95-480 FAD_binding_2
Fumarate reductase/succinate dehydrogenase flavopr

IIGSGIAGLRYALEVAKYGSVAVITKAESHECNTNYAQGGVSAVLGPSDSVESHMKDTIVAGAYLCDEESVRVVCTEGPERVRELIAMGASFDHGEDGNLHLMREGGHSHHRIVHAADMTGKEIERALLKAVINNPNIFVFEHHFAIDLLTCQDESDIICLGVDTLNTKTLEVGTAVIRFLSKATLLASGGAGHIYPKTTNPLVATGDGIAMAHRAQALISNMEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSL

superfamily: SSF56425
317-440 SSF56425

MEFVQFHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVPAAHY

Gene3D: G3DSA:3.90.700.10
322-436 G3DSA:3.90.700.10

FHPTALADEGLPIKQTKPREKAFLISEAVRGDGGILYNLGMERFMPLYDERAELAPRDVVARSIDDQLKKRDEKYVLLDISHKPKEEILSHFPNISSTCLKYGLDITRHPIPVVP

Gene3D: G3DSA:3.50.50.60
437-496 G3DSA:3.50.50.60

AAHYMCGGVQAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRAVQPSVD

FPrintScan: PR00368
IPR013027
443-465 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

GGVQAGLQGETNVKGLYVAGEVA

superfamily: SSF46977
IPR015939
533-666 Succ_DH_flav_C
Fumarate reductase/succinate dehydrogenase flavopr

TKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPHLEESKRLPTIIFPSSTVNSTWSSRQLHKQPMYQEGIKLCHNTY

Gene3D: G3DSA:1.20.58.100
IPR015939
533-623 Fum_Rdtase/Succ_DH_flav-like_C
Fumarate reductase/succinate dehydrogenase flavopr

TKESRTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPH

HMMPfam: PF02910
IPR004112
537-637 Succ_DH_flav_C
Fumarate reductase/succinate dehydrogenase flavopr

RTELQSIMWNYVGIVRSTMRLETAKQNICNLEAKWEECLFEHGWKPTMAGPEICEMRNLFCCAKLVISSALSRHESRGLHYTVDFPHLEESKRLPTIIFPS


List of References

Perrine David, Nicolas W G Chen, Andrea Pedrosa-Harand, Vincent Thareau, Mireille Sévignac, Steven B Cannon, Daniel Debouck, Thierry Langin, Valérie Geffroy
A nomadic subtelomeric disease resistance gene cluster in common bean.
Plant Physiol.: 2009, 151(3);1048-65
PubMed:19776165 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox