PRGDB00063597 (quinone oxidoreductase-like protein)

From PRG Wiki
Jump to: navigation, search
quinone oxidoreductase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342091 (FJ817291)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC B4-410, complete sequence.

DNA Sequence

ATGGCAGAAGCTGCATCAAGCACTGATTCTACTATTCCAACCCACACAAAAGCTTGGTACTACTCTGAACATGGTAGTCCAGCTGATGTTCTAAAGTTTGATCTCAATTGGCCCTTACCACAGCTCAAAGATGATCAAGTGCTCATCAAGGTCATAGCAGTATCCCTTAATCCAGTTGATTACAAGAGGATACATGGGGTGTTCAAGGACACAGACCCTTATCTACCTAAGATTGTGCCTGGTTTTGATGTTGCTGGCATAGTGGTGAGAGTGGGAGGAGAAGTAAGGAAATTTAATGTTGGAGATGAAGTGTATGGTGATATCAACGAGCAAGGGTTGTCGAATCTTAAGATTCTTGGGACTTTGTCAGAGTATACTGTTGCAGAAGAGAGACTATTGGCTCACAAACCATCCAATTTAAGTTTCATTGAAGCAGCTAGCATTCCTTTGGCACTTGAGACTGCCTTTGAAGGTTTTGAGCATGCTCAGTTTTCTGCTGCCAAATCTATCCTTGTTTTGGGAGGAGCTGGTGGAGTTGGAAGCTATGCCATTCAGCTAGCCAAACATGTTTATAAGGCATCTGTGATAGCAGCAACAGCAAGCACTGGAAAACTTGAAGTTTTAAGGGAGTTAGGAGTTGACTTGGCTATTGATTATACAAAGCACAACTTTGAAGAACTTCCAGAAAAATATGATCTTGTGTATGATACAGTAGGGCAAGCTGATAGAGCCTTCAAGGCCATCAAAGAAGATGGAAAAGTTGTGACAATAGTACCACCTGGATATCCACCAGCAATCACTTTTGTGTTAACTTCCAAAGGATCAATCTTAGAGAAATTGAGACCTTACTTTGAGAGTGGTCAAGTGAAGCCAATACTTGATGCCAAGACTCCATTGCCATTTTCTCAGCTTGTTGAAGCCATTTCCTACTTAGAAACTTCAAGAGCCACAGGGAAAGTGGTTGTTTATCCCATACCCTGA


Protein sequences

Name Description Sequence
quinone oxidoreductase-like protein quinone oxidoreductase-like protein [Phaseolus vulgaris].

MAEAASSTDSTIPTHTKAWYYSEHGSPADVLKFDLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSNLKILGTLSEYTVAEERLLAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYKASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGYPPAITFVLTSKGSILEKLRPYFESGQVKPILDAKTPLPFSQLVEAISYLETSRATGKVVVYPIP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11695:SF34
4-326 PTHR11695:SF34,ALCOHOL DEHYDROGENASE

AASSTDSTIPTHTKAWYYSEHGSPADVLKFDLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSNLKILGTLSEYTVAEERLLAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYKASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGYPPAITFVLTSKGSILEKLRPYFESGQVKPILDAKTPLPFSQLVEAISYLETSRATGKVVVYPIP

HMMPanther: PTHR11695
IPR002085
4-326 ADH_Sf_Zn
Alcohol dehydrogenase superfamily, zinc-containing

AASSTDSTIPTHTKAWYYSEHGSPADVLKFDLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSNLKILGTLSEYTVAEERLLAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYKASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGYPPAITFVLTSKGSILEKLRPYFESGQVKPILDAKTPLPFSQLVEAISYLETSRATGKVVVYPIP

superfamily: SSF50129
IPR011032
10-174 GroES_like
GroES-like

STIPTHTKAWYYSEHGSPADVLKFDLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSNLKILGTLSEYTVAEERLLAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLG

Gene3D: G3DSA:3.90.180.10
15-174 G3DSA:3.90.180.10

HTKAWYYSEHGSPADVLKFDLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSNLKILGTLSEYTVAEERLLAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLG

HMMPfam: PF08240
IPR013154
45-107 ADH_N
Alcohol dehydrogenase GroES-like

DQVLIKVIAVSLNPVDYKRIHGVFKDTDPYLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGD

superfamily: SSF51735
140-292 NAD(P)-bd

LSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYKASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGYPPAITFVLTSKGSILEKLRPYFESGQVKPI

Gene3D: G3DSA:3.40.50.720
IPR016040
175-262 NAD(P)-bd
NAD(P)-binding domain

GAGGVGSYAIQLAKHVYKASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGY

HMMPfam: PF13602
211-322 ADH_zinc_N_2,Zinc-binding dehydrogenase

LGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVVTIVPPGYPPAITFVLTSKGSILEKLRPYFESGQVKPILDAKTPLPFSQLVEAISYLETSRATGKVVV


List of References

Perrine David, Nicolas W G Chen, Andrea Pedrosa-Harand, Vincent Thareau, Mireille Sévignac, Steven B Cannon, Daniel Debouck, Thierry Langin, Valérie Geffroy
A nomadic subtelomeric disease resistance gene cluster in common bean.
Plant Physiol.: 2009, 151(3);1048-65
PubMed:19776165 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox