PRGDB00063603 (formate dehydrogenase)

From PRG Wiki
Jump to: navigation, search
formate dehydrogenase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342091 (FJ817291)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC B4-410, complete sequence.

DNA Sequence

TTACGATATGCTGCTGGTGTGAAAGACATGCTTGATAGGCACTTTAGGGGTGAAGACTTCCCAGAACAGAACTACATTGTGAAGGAGGGTCAACTTGCAAGCCAATATAGGTGAGTTACAGTGGTGATGTTTGGTTCCCACAACCAGCTCCAAAGGATCATCCATGGCGCTACATGCCAAACCATGCCATGACTCCTCATGTTTCTGGCACTACCATAGATGCACAGGGGATTGTTTGACAAAGATAAAATTTCCAAGTGCAAGAAAGGTGTCTTGATTGTTAACAATGCTAGAGGGGCTATTATGGATACCCAAGCAGTTGCTGATGCTTGCTCAAATGGCCATGTGGCAGAACTTGAGAGAAATCTTCCTGATGCACATGTTGTCATATCTACTCCATTTCACCCTGCCTATGTCACTGCTGAAAGAATAAAGAAAGCCAAAAATTTAGAGCTGCTTTTGACTGCTGGCATTGGTTCAGATCACATTGATCTCAAGGCTGCATCTGCAGCTGGTATAACTGTGGCAGAGGTCACTGGAAGCAATGTGGTGTCAGTTGCTGAGGATGAACTCATGAGAATCCTAATTCTAATTAGGAATTTCCTTCCAGGGTACCATCAGTCTGTTAATGGGGAATGGAATGTTGCTGGCATTGCTCACCGAGCTTATGATCTTGAAGGCAAGACAGTAGGAACCGTAGGTGCGGGACGAATTGGGAAACTTTTACTCCAAAGGTTGAAACCTTTCAACTGTAATCTTCTGTATTTTGATCGAATTAGGATGGATCCTGGATTAGAGAAAGAGATTGGAGCAAATTTTGAGGAGGACCTTGATGCCATGCTTCCAAAGTGTGATGTTATTGTTATCAACACGCCTCTTACTGAGCAGACAAGAAGAAGATTGTGGGGGTGTTCTACAAAGGGAATGAGTATGCAAAACTGAATCCTGATTTTGTGGGGTGTGTCGAAGGAGCATTGGGTATACGCGAGTGGCTGGAATCGCAGGGTCATCAGTATATTGTCACTGATGACAAAGAAGGACCAGATTCTGATGGCTATGAAACGTGCTGCGGCTTCCTCTGCGTTTCGCTCTCTGCTTTCTTCCACCTTCTCCCGAAACCTTCAT


Protein sequences

Name Description Sequence
formate dehydrogenase formate dehydrogenase [Phaseolus vulgaris].

MAMKRAAASSAFRSLLSSTFSRNLHKKIVGVFYKGNEYAKLNPDFVGCVEGALGIREWLESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVSGTTIDAQLRYAAGVKDMLDRHFRGEDFPEQNYIVKEGQLASQYR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.720
IPR016040
21-178 NAD(P)-bd
NAD(P)-binding domain

SRNLHKKIVGVFYKGNEYAKLNPDFVGCVEGALGIREWLESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGI

superfamily: SSF52283
26-179 SSF52283

KKIVGVFYKGNEYAKLNPDFVGCVEGALGIREWLESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIA

HMMPanther: PTHR10996:SF16
55-364 PTHR10996:SF16,FORMATE DEHYDROGENASE

IREWLESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVSGTTIDAQLRYAAGVKDMLDRHFRGEDFPEQNYIV

HMMPanther: PTHR10996
55-364 PTHR10996,2-HYDROXYACID DEHYDROGENASE-RELATED

IREWLESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVSGTTIDAQLRYAAGVKDMLDRHFRGEDFPEQNYIV

HMMPfam: PF00389
IPR006139
59-356 2-Hacid_dh
D-isomer specific 2-hydroxyacid dehydrogenase, cat

LESQGHQYIVTDDKEGPDSELERNLPDAHVVISTPFHPAYVTAERIKKAKNLELLLTAGIGSDHIDLKAASAAGITVAEVTGSNVVSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVSGTTIDAQLRYAAGVKDMLDRHFRGED

superfamily: SSF51735
144-331 NAD(P)-bd

VSVAEDELMRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVSG

HMMPfam: PF02826
IPR006140
152-330 2-Hacid_dh_C
D-isomer specific 2-hydroxyacid dehydrogenase, NAD

MRILILIRNFLPGYHQSVNGEWNVAGIAHRAYDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHVS

Gene3D: G3DSA:3.40.50.720
IPR016040
183-329 NAD(P)-bd
NAD(P)-binding domain

YDLEGKTVGTVGAGRIGKLLLQRLKPFNCNLLYFDRIRMDPGLEKEIGANFEEDLDAMLPKCDVIVINTPLTEQTRGLFDKDKISKCKKGVLIVNNARGAIMDTQAVADACSNGHVAGYSGDVWFPQPAPKDHPWRYMPNHAMTPHV

PatternScan: PS00065
IPR006140
190-217 D_2_HYDROXYACID_DH_1
D-isomer specific 2-hydroxyacid dehydrogenase, NAD

VGTVGAGRIGKLLLQRLKPFNCNLLYFD

PatternScan: PS00670
IPR006140
240-262 D_2_HYDROXYACID_DH_2
D-isomer specific 2-hydroxyacid dehydrogenase, NAD

MLPKCDVIVINTPLTEQTRGLFD

PatternScan: PS00671
IPR006140
269-285 D_2_HYDROXYACID_DH_3
D-isomer specific 2-hydroxyacid dehydrogenase, NAD

CKKGVLIVNNARGAIMD


List of References

Perrine David, Nicolas W G Chen, Andrea Pedrosa-Harand, Vincent Thareau, Mireille Sévignac, Steven B Cannon, Daniel Debouck, Thierry Langin, Valérie Geffroy
A nomadic subtelomeric disease resistance gene cluster in common bean.
Plant Physiol.: 2009, 151(3);1048-65
PubMed:19776165 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox