PRGDB00063641 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

GTGCAATCAGGGGTGCTAACTATCAAGGACAAGCAAGATATAATGCAAGCTCAGCTGCAATTTGCAAAGCTACAAATGTCCAATACGAATCAGAAACCAGAAGCTCAATCTAGCACCATTAACGTTCCTGTGCAGCAAGCTGTTCCTGCTCCTGTGCAATCTCAACCACAGCTTCCTACCCCTGCTAATCTTCCTCAATCAGTTCCAGTTGTTCCTCCCCCTAATGCTCCTCCTCAACCTCCTCCACAACAGGGTTTGCCACCTCCACCTCAAGTTCAACTTCCAAACCAATTCTCTCCAAACCAAATCCAAGCTGCTTCTCAGAGAGATCCATATTTCCCACCACCTGTTCAGTCTCAGCAGGAAACACCCAATCAGCAATACCAACTGGCGTTATCCCAGCCGCCACATTCTCAGCCTGGAGCACCGCCGCACCAGCAATATCAACAGACCCCACATCCCCAATACCCTCAACCAGCACCTCATCTACCTCAACAGCAGCCGCCGTCACATCCATCCATGAATCCACCTCAACTACAACCTCCACTGGGGCACCATGTTGAAGAACCACCTTATCCTCCTCAGACTTATCCTCCCAATGTCCGCCAGCCGCCATCTCAGTCACCCAGCGGTCCTCCTCCTCCTCAACAGTTCTACGGGACACCATCCCACTCGTATGAACCGCCATCGAGCAGACCCGGTTCCGGCTATTCTTCTGGGTATGGTACACTCTCTGGCCCTGGCCCTGCTGAGCAGTATCGCTATGGCGGCCCACCACCTCAGTATGGTAGCAATCCTGCAATGAAACCAGCACAACTGCCAACCGCTTCGGTCTCTCCGAGTGGTGGAAGCGGTTACCCCCAGCTGCCAACTGCCAGAATACTCCCACAAGCACTCCCTACTGCATCTGCAGTGAGTGGTAGCTCAGGTTCTGCTGGAACTGGAGGAAGGGTTTCTGTTGATGATGTGGTTGATAAAGTTGCTAGCATGGGATTCCCTAGAGACCATGTGAGGGCCACTGTTCGGAAGCTAACTGAGAATGGTCAATCTGTGGATCTAAACACAGTGCTGGACAAGCTTATGAATGATGGTGAAGTCCAACCCCCACGAAGTTGGTTTGGTCGGTAGAATTACAGTTCTCTGGATTCGATTGAACCTGCAAAGGTGATTGTAGAAAAGGACCGAAGTGCTTCTGATGCTTCAATGTTGGCTGAGATTGATCGGACCATGCAGAAACATATGGAAAATATGCTTAATGTACTGGAAGGTGTTAGTGCCCGGTTAACACAACTGGAAACCAGAACCCACCATCTTGAAAATTCTGTGGATGATTTGAAGGTATCTGTTGGGAATAATCATGGTATCACTGATGGAAAATTGAGGCAACTGGAGAATATTCTTCGAGAGATGAATACGACGCCGTTTATGGACAAGCAGATTATGGATCTCACTCACGGATCTTCCACTGCGCACCAACACACCAAGGACTTCATCGACCTCATGAAGCACGAACCACCGCAACAACAACACCACCATCAGCATCGCGAAGAAGACGATGATGAAGAAGAAGAAGAGAAAGCGCGTGGCAATGGGATCAGCAAGGACGACATCGTTCCCAGCTACGATTTCCAGCCGATTCGCCCTCTCGCCGCTTCCAGTTACGATTCCGCCCCCAGTTTCGCTGCTGCATTCTCTCGCCCTTGGAACTCCGAATCCAACTCCAAA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Phaseolus vulgaris].

MNTTPFMDKQIMDLTHGSSTAHQHTKDFIDLMKHEPPQQQHHHQHREEDDDEEEEEKARGNGISKDDIVPSYDFQPIRPLAASSYDSAPSFAAAFSRPWNSESNSKNYSSLDSIEPAKVIVEKDRSASDASMLAEIDRTMQKHMENMLNVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGITDGKLRQLENILREVQSGVLTIKDKQDIMQAQLQFAKLQMSNTNQKPEAQSSTINVPVQQAVPAPVQSQPQLPTPANLPQSVPVVPPPNAPPQPPPQQGLPPPPQVQLPNQFSPNQIQAASQRDPYFPPPVQSQQETPNQQYQLALSQPPHSQPGAPPHQQYQQTPHPQYPQPAPHLPQQQPPSHPSMNPPQLQPPLGHHVEEPPYPPQTYPPNVRQPPSQSPSGPPPPQQFYGTPSHSYEPPSSRPGSGYSSGYGTLSGPGPAEQYRYGGPPPQYGSNPAMKPAQLPTASVSPSGGSGYPQLPTARILPQALPTASAVSGSSGSAGTGGRVSVDDVVDKVASMGFPRDHVRATVRKLTENGQSVDLNTVLDKLMNDGEVQPPRSWFGR

Domains

Domain Start-End Description Sequence

HMMPfam: PF07223
IPR010820
197-556 DUF1421
Protein of unknown function DUF1421

LREVQSGVLTIKDKQDIMQAQLQFAKLQMSNTNQKPEAQSSTINVPVQQAVPAPVQSQPQLPTPANLPQSVPVVPPPNAPPQPPPQQGLPPPPQVQLPNQFSPNQIQAASQRDPYFPPPVQSQQETPNQQYQLALSQPPHSQPGAPPHQQYQQTPHPQYPQPAPHLPQQQPPSHPSMNPPQLQPPLGHHVEEPPYPPQTYPPNVRQPPSQSPSGPPPPQQFYGTPSHSYEPPSSRPGSGYSSGYGTLSGPGPAEQYRYGGPPPQYGSNPAMKPAQLPTASVSPSGGSGYPQLPTARILPQALPTASAVSGSSGSAGTGGRVSVDDVVDKVASMGFPRDHVRATVRKLTENGQSVDLNTVL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox