PRGDB00063642 (60S ribosomal protein)

From PRG Wiki
Jump to: navigation, search
60S ribosomal protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

TCGACGAATCATGTTGAGAAAGAAAGAACAATGTTGGACCATTAACCTCCACAAGCGCCTCCATGGCTGCACATTTAAGAAGATGAGGAAGTTTGCTCAGAAGGCCATGGGAACTAATGATGTGAAGCTGAACAAGTTGCTCAGGAGTGTTCGAAGGAGAATTAGGGTAAGAAATGCTCGTAAGAGGAATGATGATGAAGATGCCAAGGAACCCTTGTCACTCTTGTTGAAACCTGCTTCTGTGATGAAGTCAAAATTTGTGTTCTGAATGGGGACCCAACTGGGGGAGGATCCCTTTGATGTCATTACTTTGGAGAAGGGAAAGGTGGGAACTTTTGTGTTTGAGGATGGAGGAGATGAGGTTTACGACGTTGTTGGGATTCTGGGTGGGAGGCAGAAGATTGTAAAAGGGACTCAAAGTGC


Protein sequences

Name Description Sequence
60S ribosomal protein 60S ribosomal protein [Phaseolus vulgaris].

MGTQLGEDPFDVITLEKGKVGTFVFEDGGDEVYDVVGILGGRQKIVKGTQSARRIMLRKKEQCWTINLHKRLHGCTFKKMRKFAQKAMGTNDVKLNKLLRSVRRRIRVRNARKRNDDEDAKEPLSLLLKPASVMKSKFVF

Domains

Domain Start-End Description Sequence

superfamily: SSF54575
IPR023621
58-124 Ribosomal_L31e
Ribosomal protein L31e domain

RKKEQCWTINLHKRLHGCTFKKMRKFAQKAMGTNDVKLNKLLRSVRRRIRVRNARKRNDDEDAKEPL

Gene3D: G3DSA:3.10.440.10
IPR023621
60-124 Ribosomal_L31e
Ribosomal protein L31e domain

KEQCWTINLHKRLHGCTFKKMRKFAQKAMGTNDVKLNKLLRSVRRRIRVRNARKRNDDEDAKEPL

BlastProDom: PD006030
IPR000054
64-95 Ribosomal_L31e
Ribosomal protein L31e

WTINLHKRLHGCTFKKMRKFAQKAMGTNDVKL

HMMPfam: PF01198
IPR000054
64-122 Ribosomal_L31e
Ribosomal protein L31e

WTINLHKRLHGCTFKKMRKFAQKAMGTNDVKLNKLLRSVRRRIRVRNARKRNDDEDAKE

HMMPanther: PTHR10956
IPR000054
65-124 Ribosomal_L31e
Ribosomal protein L31e

TINLHKRLHGCTFKKMRKFAQKAMGTNDVKLNKLLRSVRRRIRVRNARKRNDDEDAKEPL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox