PRGDB00063643 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 270342065 (FJ817289)
Gene Class Unknown
Domain Type
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris clone BAC 48-B10, complete sequence.

DNA Sequence

ATGGAGTTATTGGCTGAATTGATACAAATGGTTGAGGTTGAGGGTGTTTGTGCTTCTTCAAATGAGGGCATTTATGAGAATCTTGTGCGCTGTACTGAGGACTGTAATTGGAACCCTGTGATATTTGATATGCTCGTCAAGGCTTATGTGAAGGTGGGAATGGTTGAGAAGGCTTTGGAAACTTTTAGGAGGAACATTGAGACTCGTCTTATCCCCAATGTGATTGCTTGCAATTGTTTGCTGAGTGGGTTGTCTAGGTTTAATTACATTACTCAATGTTGGGAAGTGTATGCAGAGATGGGAAGACTTGGAGTACAGAGGAATGCTTATACTTTCAATATTATGACCCATGTTTTAAGTAAAGATGGAGATACAGATAAGGTGACAGGGTTCTTGGAGAAGATGGAGGAGGAAGGATTTGAACCTGATTTGGTTACATATAACACACTTGTTAACAGTTATTGTAAGAAGAGGAGATTGGAGGATGCTTTTTATCTATACAAGATCATGTATGTCAGAGGTGTTATGCCTAATTTGATCACATATACAACCTTGATGAATGGTCTTTGCGAAGAAGGGAAGGTCAAGGAGGCTCATCAGCTTTTTCATCAGATGGTTCACAGAGGTATAGCTCCAGATATTGTGTCTTATAATACTCTTGTGTGTGGCTATTGCAGACATGGTGAGATGCAAATGTGTAGATCAATACTGTATGAAATGATAGGAAATAGGATTTGTCCTGACAGCATCACTTGTCGGGTTATAGTTGATGGATATGCCAGGGATGGAAAACTTCTTTCAGCCTTGAATACTGTTGAGGAGCTTAAGAGATTCAGAATGAAGATTCCTGAAGAAGTATATGATTATCTTGTAGTTGCACTGTGTAAGGAAGGTAAGCCATTTGCTGCTAGAAGTTTTCTGCATAGGATATCTGAGGATGGTTATACACCTAAAATGAACACATACAATAAACTGGTTGAGTCTCTATGTGAATTCAATAATGAGGAAGAAGCATTAATTTTGAAATCTGATATGGAAAATAAGAGCATGAAAGTGAATGCTGCTGCCTATAGAGCTGTTATAATCTGTTTGTGTAGAGTAAAGAGGACTGTGGAAGCTGAAGTTTTGTTGGAGGAAATTATTGGTTCAGATATGTTACCTGATGTAGAAATAAGCAGGGCATTAATAAAAGGGTATTGTGAGGAAAATAAGGTTGATAAAGCTGTGTCCTTGTTGAAACTCTTTGCCAAGGAGTTTCAAGTTTATGATACTGAAAGCTACAATGCAGTTGTTAAAGTGTTTTGTGATGTTGGGAATGTGACAGAGTTGATGGAGGTTGAGGATAAGCTGCTGAAAGTGGGGTATGTTCCTAACAAGTTAACATGCAGGCATGTGATCCATGGATTGCAGAAAGCTATGGAGCTAGATGATGAGATTTTGAACCATAGTTTGTCTTAG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Phaseolus vulgaris].

MELLAELIQMVEVEGVCASSNEGIYENLVRCTEDCNWNPVIFDMLVKAYVKVGMVEKALETFRRNIETRLIPNVIACNCLLSGLSRFNYITQCWEVYAEMGRLGVQRNAYTFNIMTHVLSKDGDTDKVTGFLEKMEEEGFEPDLVTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMPNLITYTTLMNGLCEEGKVKEAHQLFHQMVHRGIAPDIVSYNTLVCGYCRHGEMQMCRSILYEMIGNRICPDSITCRVIVDGYARDGKLLSALNTVEELKRFRMKIPEEVYDYLVVALCKEGKPFAARSFLHRISEDGYTPKMNTYNKLVESLCEFNNEEEALILKSDMENKSMKVNAAAYRAVIICLCRVKRTVEAEVLLEEIIGSDMLPDVEISRALIKGYCEENKVDKAVSLLKLFAKEFQVYDTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQKAMELDDEILNHSLS


Domains

Domain Start-End Description Sequence

ProfileScan: PS51375
IPR002885
38-72 PPR
Pentatricopeptide repeat

NPVIFDMLVKAYVKVGMVEKALETFRRNIETRLIP

HMMPanther: PTHR24015
38-477 PTHR24015,FAMILY NOT NAMED

NPVIFDMLVKAYVKVGMVEKALETFRRNIETRLIPNVIACNCLLSGLSRFNYITQCWEVYAEMGRLGVQRNAYTFNIMTHVLSKDGDTDKVTGFLEKMEEEGFEPDLVTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMPNLITYTTLMNGLCEEGKVKEAHQLFHQMVHRGIAPDIVSYNTLVCGYCRHGEMQMCRSILYEMIGNRICPDSITCRVIVDGYARDGKLLSALNTVEELKRFRMKIPEEVYDYLVVALCKEGKPFAARSFLHRISEDGYTPKMNTYNKLVESLCEFNNEEEALILKSDMENKSMKVNAAAYRAVIICLCRVKRTVEAEVLLEEIIGSDMLPDVEISRALIKGYCEENKVDKAVSLLKLFAKEFQVYDTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQKAMELDD

Gene3D: G3DSA:1.25.40.10
IPR011990
39-214 TPR-like_helical
Tetratricopeptide-like helical

PVIFDMLVKAYVKVGMVEKALETFRRNIETRLIPNVIACNCLLSGLSRFNYITQCWEVYAEMGRLGVQRNAYTFNIMTHVLSKDGDTDKVTGFLEKMEEEGFEPDLVTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMPNLITYTTLMNGLCEEGKVKEAHQLFHQMVHRGIAPDI

HMMTigr: TIGR00756
IPR002885
40-73 PPR
Pentatricopeptide repeat

VIFDMLVKAYVKVGMVEKALETFRRNIETRLIPN

HMMPfam: PF01535
IPR002885
41-64 PPR
Pentatricopeptide repeat

IFDMLVKAYVKVGMVEKALETFRR

HMMPfam: PF13041
IPR002885
72-121 PPR_2
Pentatricopeptide repeat

PNVIACNCLLSGLSRFNYITQCWEVYAEMGRLGVQRNAYTFNIMTHVLSK

ProfileScan: PS51375
IPR002885
73-107 PPR
Pentatricopeptide repeat

NVIACNCLLSGLSRFNYITQCWEVYAEMGRLGVQR

HMMTigr: TIGR00756
IPR002885
76-108 PPR
Pentatricopeptide repeat

ACNCLLSGLSRFNYITQCWEVYAEMGRLGVQRN

ProfileScan: PS51375
IPR002885
108-142 PPR
Pentatricopeptide repeat

NAYTFNIMTHVLSKDGDTDKVTGFLEKMEEEGFEP

HMMTigr: TIGR00756
IPR002885
110-143 PPR
Pentatricopeptide repeat

YTFNIMTHVLSKDGDTDKVTGFLEKMEEEGFEPD

HMMPfam: PF13041
IPR002885
142-191 PPR_2
Pentatricopeptide repeat

PDLVTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMPNLITYTTLMNGLCE

ProfileScan: PS51375
IPR002885
143-177 PPR
Pentatricopeptide repeat

DLVTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMP

HMMTigr: TIGR00756
IPR002885
145-178 PPR
Pentatricopeptide repeat

VTYNTLVNSYCKKRRLEDAFYLYKIMYVRGVMPN

ProfileScan: PS51375
IPR002885
178-212 PPR
Pentatricopeptide repeat

NLITYTTLMNGLCEEGKVKEAHQLFHQMVHRGIAP

HMMTigr: TIGR00756
IPR002885
180-214 PPR
Pentatricopeptide repeat

ITYTTLMNGLCEEGKVKEAHQLFHQMVHRGIAPDI

HMMPfam: PF13041
IPR002885
212-260 PPR_2
Pentatricopeptide repeat

PDIVSYNTLVCGYCRHGEMQMCRSILYEMIGNRICPDSITCRVIVDGYA

ProfileScan: PS51375
IPR002885
213-247 PPR
Pentatricopeptide repeat

DIVSYNTLVCGYCRHGEMQMCRSILYEMIGNRICP

HMMTigr: TIGR00756
IPR002885
215-249 PPR
Pentatricopeptide repeat

VSYNTLVCGYCRHGEMQMCRSILYEMIGNRICPDS

ProfileScan: PS51375
IPR002885
248-282 PPR
Pentatricopeptide repeat

DSITCRVIVDGYARDGKLLSALNTVEELKRFRMKI

ProfileScan: PS51375
IPR002885
283-317 PPR
Pentatricopeptide repeat

PEEVYDYLVVALCKEGKPFAARSFLHRISEDGYTP

HMMPfam: PF01535
IPR002885
287-314 PPR
Pentatricopeptide repeat

YDYLVVALCKEGKPFAARSFLHRISEDG

ProfileScan: PS51375
IPR002885
318-352 PPR
Pentatricopeptide repeat

KMNTYNKLVESLCEFNNEEEALILKSDMENKSMKV

ProfileScan: PS51375
IPR002885
353-387 PPR
Pentatricopeptide repeat

NAAAYRAVIICLCRVKRTVEAEVLLEEIIGSDMLP

HMMPfam: PF01535
IPR002885
356-383 PPR
Pentatricopeptide repeat

AYRAVIICLCRVKRTVEAEVLLEEIIGS

HMMTigr: TIGR00756
IPR002885
356-389 PPR
Pentatricopeptide repeat

AYRAVIICLCRVKRTVEAEVLLEEIIGSDMLPDV

ProfileScan: PS51375
IPR002885
388-418 PPR
Pentatricopeptide repeat

DVEISRALIKGYCEENKVDKAVSLLKLFAKE

HMMPfam: PF01535
IPR002885
394-413 PPR
Pentatricopeptide repeat

ALIKGYCEENKVDKAVSLLK

ProfileScan: PS51375
IPR002885
423-457 PPR
Pentatricopeptide repeat

DTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox